| UniProt ID | THYN1_HUMAN | |
|---|---|---|
| UniProt AC | Q9P016 | |
| Protein Name | Thymocyte nuclear protein 1 | |
| Gene Name | THYN1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 225 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Specifically binds 5-hydroxymethylcytosine (5hmC), suggesting that it acts as a specific reader of 5hmC.. | |
| Protein Sequence | MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEEKEPS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Phosphorylation | PRKRLAGTSGSDKGL CCCCCCCCCCCCCCC | 25.06 | 23684312 | |
| 12 | Phosphorylation | RKRLAGTSGSDKGLS CCCCCCCCCCCCCCC | 35.07 | 21712546 | |
| 14 | Phosphorylation | RLAGTSGSDKGLSGK CCCCCCCCCCCCCCC | 35.60 | 23401153 | |
| 16 | Acetylation | AGTSGSDKGLSGKRT CCCCCCCCCCCCCCE | 64.55 | 23954790 | |
| 16 | Ubiquitination | AGTSGSDKGLSGKRT CCCCCCCCCCCCCCE | 64.55 | - | |
| 19 | Phosphorylation | SGSDKGLSGKRTKTE CCCCCCCCCCCEECC | 51.44 | 23401153 | |
| 21 | Acetylation | SDKGLSGKRTKTENS CCCCCCCCCEECCCC | 54.22 | 25953088 | |
| 23 | Phosphorylation | KGLSGKRTKTENSGE CCCCCCCEECCCCHH | 45.89 | 26074081 | |
| 24 | Sumoylation | GLSGKRTKTENSGEA CCCCCCEECCCCHHH | 58.85 | - | |
| 24 | Ubiquitination | GLSGKRTKTENSGEA CCCCCCEECCCCHHH | 58.85 | - | |
| 24 | Sumoylation | GLSGKRTKTENSGEA CCCCCCEECCCCHHH | 58.85 | - | |
| 25 | Phosphorylation | LSGKRTKTENSGEAL CCCCCEECCCCHHHH | 39.52 | 26074081 | |
| 28 | Phosphorylation | KRTKTENSGEALAKV CCEECCCCHHHHHHC | 31.60 | 25159151 | |
| 34 | Acetylation | NSGEALAKVEDSNPQ CCHHHHHHCCCCCCC | 47.19 | 26051181 | |
| 34 | Ubiquitination | NSGEALAKVEDSNPQ CCHHHHHHCCCCCCC | 47.19 | - | |
| 42 | Acetylation | VEDSNPQKTSATKNC CCCCCCCCCHHHHHH | 45.78 | 25953088 | |
| 42 | Ubiquitination | VEDSNPQKTSATKNC CCCCCCCCCHHHHHH | 45.78 | - | |
| 44 | Phosphorylation | DSNPQKTSATKNCLK CCCCCCCHHHHHHHH | 40.76 | 25627689 | |
| 51 | Acetylation | SATKNCLKNLSSHWL HHHHHHHHHHHHHCH | 59.03 | 23954790 | |
| 54 | Phosphorylation | KNCLKNLSSHWLMKS HHHHHHHHHHCHHCC | 29.56 | 27251275 | |
| 55 | Phosphorylation | NCLKNLSSHWLMKSE HHHHHHHHHCHHCCC | 23.11 | 27251275 | |
| 60 | Ubiquitination | LSSHWLMKSEPESRL HHHHCHHCCCCHHHH | 49.88 | - | |
| 60 | Sumoylation | LSSHWLMKSEPESRL HHHHCHHCCCCHHHH | 49.88 | - | |
| 60 | Sumoylation | LSSHWLMKSEPESRL HHHHCHHCCCCHHHH | 49.88 | - | |
| 60 | Acetylation | LSSHWLMKSEPESRL HHHHCHHCCCCHHHH | 49.88 | 25953088 | |
| 61 | Phosphorylation | SSHWLMKSEPESRLE HHHCHHCCCCHHHHH | 44.40 | 27251275 | |
| 65 | Phosphorylation | LMKSEPESRLEKGVD HHCCCCHHHHHCCCC | 53.53 | 27251275 | |
| 69 | Acetylation | EPESRLEKGVDVKFS CCHHHHHCCCCEEEE | 69.68 | 25953088 | |
| 69 | Ubiquitination | EPESRLEKGVDVKFS CCHHHHHCCCCEEEE | 69.68 | - | |
| 74 | Sumoylation | LEKGVDVKFSIEDLK HHCCCCEEEEHHHHC | 29.00 | - | |
| 74 | Sumoylation | LEKGVDVKFSIEDLK HHCCCCEEEEHHHHC | 29.00 | - | |
| 76 | O-linked_Glycosylation | KGVDVKFSIEDLKAQ CCCCEEEEHHHHCCC | 21.25 | 28510447 | |
| 81 (in isoform 2) | Acetylation | - | 58.24 | - | |
| 81 | Ubiquitination | KFSIEDLKAQPKQTT EEEHHHHCCCCCCCC | 58.24 | 19608861 | |
| 81 | Acetylation | KFSIEDLKAQPKQTT EEEHHHHCCCCCCCC | 58.24 | 19608861 | |
| 85 | Ubiquitination | EDLKAQPKQTTCWDG HHHCCCCCCCCCCHH | 48.47 | - | |
| 87 | Phosphorylation | LKAQPKQTTCWDGVR HCCCCCCCCCCHHHH | 30.01 | 24043423 | |
| 88 | Phosphorylation | KAQPKQTTCWDGVRN CCCCCCCCCCHHHHH | 14.76 | 24043423 | |
| 106 | Acetylation | RNFLRAMKLGEEAFF HHHHHHHHHCCHHEE | 52.97 | 25953088 | |
| 119 | Ubiquitination | FFYHSNCKEPGIAGL EECCCCCCCCCHHHH | 71.80 | - | |
| 119 | Acetylation | FFYHSNCKEPGIAGL EECCCCCCCCCHHHH | 71.80 | 25953088 | |
| 128 | Ubiquitination | PGIAGLMKIVKEAYP CCHHHHHHHHHHHCC | 49.76 | - | |
| 128 | Acetylation | PGIAGLMKIVKEAYP CCHHHHHHHHHHHCC | 49.76 | 25953088 | |
| 131 | Acetylation | AGLMKIVKEAYPDHT HHHHHHHHHHCCCCC | 39.85 | 26051181 | |
| 131 | Ubiquitination | AGLMKIVKEAYPDHT HHHHHHHHHHCCCCC | 39.85 | - | |
| 142 | Ubiquitination | PDHTQFEKNNPHYDP CCCCCHHHCCCCCCC | 64.41 | - | |
| 152 | Ubiquitination | PHYDPSSKEDNPKWS CCCCCCCCCCCCCCC | 73.71 | - | |
| 152 | Acetylation | PHYDPSSKEDNPKWS CCCCCCCCCCCCCCC | 73.71 | 25953088 | |
| 179 | Ubiquitination | FIPLAELKSYHQAHK HCCHHHHHHHHHHHH | 40.24 | - | |
| 179 | Acetylation | FIPLAELKSYHQAHK HCCHHHHHHHHHHHH | 40.24 | 25953088 | |
| 186 | Ubiquitination | KSYHQAHKATGGPLK HHHHHHHHHHCCCHH | 51.13 | - | |
| 188 | Phosphorylation | YHQAHKATGGPLKNM HHHHHHHHCCCHHHH | 47.69 | - | |
| 199 | Phosphorylation | LKNMVLFTRQRLSIQ HHHHEEEECCCCCCC | 23.02 | - | |
| 204 | Phosphorylation | LFTRQRLSIQPLTQE EEECCCCCCCCCCHH | 22.74 | 27251275 | |
| 209 | Phosphorylation | RLSIQPLTQEEFDFV CCCCCCCCHHHCCEE | 40.39 | - | |
| 218 | Phosphorylation | EEFDFVLSLEEKEPS HHCCEEEECCCCCCC | 28.56 | - | |
| 225 | Phosphorylation | SLEEKEPS------- ECCCCCCC------- | 54.68 | 26714015 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THYN1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THYN1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THYN1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SHPK_HUMAN | SHPK | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-81, AND MASS SPECTROMETRY. | |