dbPTM

GIF1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GIF1_ARATH
UniProt AC	Q8L8A5
Protein Name	GRF1-interacting factor 1
Gene Name	GIF1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	210
Subcellular Localization
Protein Description	Transcription coactivator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. Appears to function synergistically with GRF1 as a transcriptional coactivator. Acts together with GRF5 for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation activity in leaf primordia. Plays a role in adaxial/abaxial patterning and growth in leaf morphogenesis. GIFs are involved in the positive regulation of cell proliferation of lateral organs in a functionally redundant manner..
Protein Sequence	MQQHLMQMQPMMAGYYPSNVTSDHIQQYLDENKSLILKIVESQNSGKLSECAENQARLQRNLMYLAAIADSQPQPPSVHSQYGSAGGGMIQGEGGSHYLQQQQATQQQQMTQQSLMAARSSMLYAQQQQQQQPYATLQHQQLHHSQLGMSSSSGGGGSSGLHILQGEAGGFHDFGRGKPEMGSGGGGEGRGGSSGDGGETLYLKSSDDGN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
193	Phosphorylation	GGEGRGGSSGDGGET CCCCCCCCCCCCCCE		30291188
194	Phosphorylation	GEGRGGSSGDGGETL CCCCCCCCCCCCCEE		22440515

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GIF1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GIF1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GIF1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
14331_ARATH	GRF1	physical	15326298
GRF9_ARATH	GRF9	physical	24285851
ARP4_ARATH	ARP4	physical	25521792
ARP7_ARATH	ARP7	physical	25521792
GRF5_ARATH	GRF5	physical	24888433
GRF3_ARATH	GRF3	physical	24888433
BRM_ARATH	BRM	physical	24888433
ARP7_ARATH	ARP7	physical	24888433
CHR12_ARATH	ATCHR12	physical	24888433
MSI1_ARATH	MSI1	physical	24888433
SNF12_ARATH	CHC1	physical	24888433
SYD_ARATH	SYD	physical	24888433
CHR4_ARATH	CHR4	physical	24888433
JAL22_ARATH	JAL22	physical	24888433
GIF1_ARATH	AN3	physical	24888433
SLK2_ARATH	SLK2	physical	24888433
Y4645_ARATH	AT4G26450	physical	24888433
TIC_ARATH	TIC	physical	24888433
BLH9_ARATH	RPL	physical	24888433
RLA23_ARATH	AT3G28500	physical	24888433
OBE4_ARATH	AT3G63500	physical	24888433
JAL23_ARATH	JAL23	physical	24888433
BGL19_ARATH	BGLU19	physical	24888433
BGL22_ARATH	BGLU22	physical	24888433
BGL21_ARATH	BGLU21	physical	24888433
BGL23_ARATH	PYK10	physical	24888433
JAL7_ARATH	MBP1	physical	24888433
EF1G1_ARATH	AT1G09640	physical	24888433
EF1G2_ARATH	AT1G57720	physical	24888433
GDL20_ARATH	AT1G54020	physical	24888433
ALFL4_ARATH	AL4	physical	24888433
ALFL5_ARATH	AL5	physical	24888433
SPL8_ARATH	SPL8	physical	24888433
JAL35_ARATH	JR1	physical	24888433
BGL18_ARATH	BGLU18	physical	24888433
RK14_ARATH	rpl14	physical	24888433

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GIF1_ARATH

Related Literatures of Post-Translational Modification