UniProt ID | BGL19_ARATH | |
---|---|---|
UniProt AC | Q9LIF9 | |
Protein Name | Beta-glucosidase 19 | |
Gene Name | BGLU19 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 527 | |
Subcellular Localization | Endoplasmic reticulum lumen . | |
Protein Description | ||
Protein Sequence | MKIPLLGLLLLISLVGSPTRAEEGPVCPKTETLSRASFPEGFMFGTATAAFQVEGAVNEGCRGPSLWDIYTKKFPHRVKNHNADEAVDFYHRYKEDIQLMKKLNTDGFRLSISWPRIFPHGRMEKGISKEGVQFYHDLIDELLKNDITPLVTVFHWDTPADLEDEYGGFLSERIVPDFVEYANFTFHEYGDKVKNWITFNEPWVFSRSGYDVGKKAPGRCSPYVKEFGKLCQDGRSGFEPYVVSHNLLVGHAEAVDAFRKCEKCKGGKIGIAHSPAWFEPEDVEGGQATVNRVLDFVIGWHLDPTTFGDYPQSMKDAVGSRLPRFTKAQKAKLKDSTDFVGINYYTSFFAKADQKVDSRNPTWATDALVEFEPKTVDGSIKIGSQPNTAKMAVYAKGLRKLMKYIKDRYNSPEIIITENGYGEDLGDKDTDLSVALNDHNRKYYLQRHLLALNEAICEDKVNVTSYFLWSLMDNFEWQDGYTARFGVYYIDFKNNLTRMEKESAKWLSEFLKPGLKPSKSSKLHEEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
113 | Phosphorylation | DGFRLSISWPRIFPH CCCCEEEECCEECCC | 27.87 | 30291188 | |
183 | N-linked_Glycosylation | PDFVEYANFTFHEYG CCHHHHCCEEEECCC | 35.27 | - | |
462 | N-linked_Glycosylation | AICEDKVNVTSYFLW HHHHCCCCHHHHHHH | 36.77 | - | |
495 | N-linked_Glycosylation | YYIDFKNNLTRMEKE EEEECCCCCCHHHHH | 43.30 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BGL19_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BGL19_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BGL19_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of BGL19_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...