BGL19_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BGL19_ARATH
• UniProt AC: Q9LIF9
• Protein Name: Beta-glucosidase 19
• Gene Name: BGLU19
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 527
• Subcellular Localization: Endoplasmic reticulum lumen .
• Protein Sequence: MKIPLLGLLLLISLVGSPTRAEEGPVCPKTETLSRASFPEGFMFGTATAAFQVEGAVNEGCRGPSLWDIYTKKFPHRVKNHNADEAVDFYHRYKEDIQLMKKLNTDGFRLSISWPRIFPHGRMEKGISKEGVQFYHDLIDELLKNDITPLVTVFHWDTPADLEDEYGGFLSERIVPDFVEYANFTFHEYGDKVKNWITFNEPWVFSRSGYDVGKKAPGRCSPYVKEFGKLCQDGRSGFEPYVVSHNLLVGHAEAVDAFRKCEKCKGGKIGIAHSPAWFEPEDVEGGQATVNRVLDFVIGWHLDPTTFGDYPQSMKDAVGSRLPRFTKAQKAKLKDSTDFVGINYYTSFFAKADQKVDSRNPTWATDALVEFEPKTVDGSIKIGSQPNTAKMAVYAKGLRKLMKYIKDRYNSPEIIITENGYGEDLGDKDTDLSVALNDHNRKYYLQRHLLALNEAICEDKVNVTSYFLWSLMDNFEWQDGYTARFGVYYIDFKNNLTRMEKESAKWLSEFLKPGLKPSKSSKLHEEL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
113	Phosphorylation	DGFRLSISWPRIFPH CCCCEEEECCEECCC	27.87	30291188
183	N-linked_Glycosylation	PDFVEYANFTFHEYG CCHHHHCCEEEECCC	35.27	-
462	N-linked_Glycosylation	AICEDKVNVTSYFLW HHHHCCCCHHHHHHH	36.77	-
495	N-linked_Glycosylation	YYIDFKNNLTRMEKE EEEECCCCCCHHHHH	43.30	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BGL19_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BGL19_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BGL19_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of BGL19_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.