EF1G2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: EF1G2_ARATH
• UniProt AC: Q9FVT2
• Protein Name: Probable elongation factor 1-gamma 2
• Gene Name: At1g57720
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 413
• Protein Description: Probably plays a role in anchoring the complex to other cellular components..
• Protein Sequence: MALVMHTYKGNKGANKALIAAEYAGVKIEESADFQMGVTNKSPEFLKMNPIGKVPVLETPEGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHIEQWIDFSSLEIDANMLKWFAPRMGYAPFSAPAEEAAISALKRGLEALNTHLASNTFLVGHSVTLADIVTICNLNLGFATVMTKKFTSAFPHVERYFWTMVNQPEFKKVLGDAKQTEAVPPVPTKKAPQPAKPKEEPKKAAPVAEAPKPAEEEEAPKPKAKNPLDLLPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
67	Phosphorylation	PEGPIFESNAIARYV CCCCCCCHHHHHHHH	22.32	30291188
314	Phosphorylation	YNDENMVSFVTLNKV ECCCCEEEEEEEECC	11.84	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of EF1G2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of EF1G2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of EF1G2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EF1D2_ARATH	AT2G18110	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.