ALFL4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ALFL4_ARATH
• UniProt AC: O81488
• Protein Name: PHD finger protein ALFIN-LIKE 4
• Gene Name: AL4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 255
• Subcellular Localization: Nucleus .
• Protein Description: Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes..
• Protein Sequence: MEAGGAYNPRTVEEVFRDFKGRRAGMIKALTTDVQEFFRLCDPEKENLCLYGHPNEHWEVNLPAEEVPPELPEPVLGINFARDGMAEKDWLSLVAVHSDAWLLAVAFFFGARFGFDKADRKRLFNMVNDLPTIFEVVAGTAKKQGKDKSSVSNNSSNRSKSSSKRGSESRAKFSKPEPKDDEEEEEEGVEEEDEDEQGETQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKRARS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEAGGAYN -------CCCCCCCC	7.80	22223895
149	Phosphorylation	KKQGKDKSSVSNNSS HHCCCCHHHCCCCCC	46.21	29654922
150	Phosphorylation	KQGKDKSSVSNNSSN HCCCCHHHCCCCCCC	34.99	25561503
152	Phosphorylation	GKDKSSVSNNSSNRS CCCHHHCCCCCCCCC	32.04	29654922
155	Phosphorylation	KSSVSNNSSNRSKSS HHHCCCCCCCCCCCC	32.99	19880383
156	Phosphorylation	SSVSNNSSNRSKSSS HHCCCCCCCCCCCCC	38.08	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ALFL4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ALFL4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ALFL4_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of ALFL4_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.