ALFL5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ALFL5_ARATH
• UniProt AC: Q5XEM9
• Protein Name: PHD finger protein ALFIN-LIKE 5
• Gene Name: AL5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 260
• Subcellular Localization: Nucleus .
• Protein Description: Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes..
• Protein Sequence: MEGGTAHYSPRTVEEVFRDFKGRRAGIIQALTTDVEDFFQQCDPEKQNLCLYGFPNEVWEVNLPAEEVPPELPEPALGINFARDGMQERNWLSLVAVHSDAWLLSVSFYFGSRFGFDRADRKRLFSMINEVPTVYEVVTGNAEKQTKEMPSSANQNGNRSKSNSKMRGLESKSSKTIHAKDEEEGLELEEGEEEEDEDEDEHGETLCGACGDNYASDEFWICCDMCEKWFHGECVKITPARAEHIKHYKCPTCSNKRARP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEGGTAHY -------CCCCCCCC	11.02	-
8	Phosphorylation	MEGGTAHYSPRTVEE CCCCCCCCCCCHHHH	20.22	25561503
9	Phosphorylation	EGGTAHYSPRTVEEV CCCCCCCCCCHHHHH	9.68	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ALFL5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ALFL5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ALFL5_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of ALFL5_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.