UniProt ID | RLA23_ARATH | |
---|---|---|
UniProt AC | Q9LH85 | |
Protein Name | 60S acidic ribosomal protein P2-3 | |
Gene Name | RPP2C | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 115 | |
Subcellular Localization | ||
Protein Description | Plays an important role in the elongation step of protein synthesis.. | |
Protein Sequence | MKVIAAFLLAKLGGNENPTSNDLKKILESVGAEIDETKIDLLFSLIKDHDVTELIAAGREKMSALSSGGPAVAMVAGGGGGGAASAAEPVAESKKKVEEVKDESSDDAGMMGLFD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RLA23_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RLA23_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RLA23_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RLA23_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Site-specific phosphorylation profiling of Arabidopsis proteins bymass spectrometry and peptide chip analysis."; de la Fuente van Bentem S., Anrather D., Dohnal I., Roitinger E.,Csaszar E., Joore J., Buijnink J., Carreri A., Forzani C.,Lorkovic Z.J., Barta A., Lecourieux D., Verhounig A., Jonak C.,Hirt H.; J. Proteome Res. 7:2458-2470(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-104 AND SER-105, ANDMASS SPECTROMETRY. |