dbPTM

RLA23_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RLA23_ARATH
UniProt AC	Q9LH85
Protein Name	60S acidic ribosomal protein P2-3
Gene Name	RPP2C
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	115
Subcellular Localization
Protein Description	Plays an important role in the elongation step of protein synthesis..
Protein Sequence	MKVIAAFLLAKLGGNENPTSNDLKKILESVGAEIDETKIDLLFSLIKDHDVTELIAAGREKMSALSSGGPAVAMVAGGGGGGAASAAEPVAESKKKVEEVKDESSDDAGMMGLFD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
104	Phosphorylation	VEEVKDESSDDAGMM HHHHCCCCCCCCCCC	49.56	24601666
105	Phosphorylation	EEVKDESSDDAGMMG HHHCCCCCCCCCCCC	37.15	17317660

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RLA23_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RLA23_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RLA23_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RLA23_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RLA23_ARATH

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Site-specific phosphorylation profiling of Arabidopsis proteins bymass spectrometry and peptide chip analysis."; de la Fuente van Bentem S., Anrather D., Dohnal I., Roitinger E.,Csaszar E., Joore J., Buijnink J., Carreri A., Forzani C.,Lorkovic Z.J., Barta A., Lecourieux D., Verhounig A., Jonak C.,Hirt H.; J. Proteome Res. 7:2458-2470(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-104 AND SER-105, ANDMASS SPECTROMETRY.	18433157 [Abstract]