GDL20_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GDL20_ARATH
• UniProt AC: Q9C5N8
• Protein Name: GDSL esterase/lipase At1g54020
• Gene Name: At1g54020
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 372
• Subcellular Localization: Secreted .
• Protein Sequence: MECSSVSVLGILLVFPLLHNLVTISGQNLPAVGLFTFGDSNFDAGNKKFLTSAPLPQNFWPYGKSRDDPKGKFSDGKIVPDFIAKFMGIPHDLPPALKPGTDVSRGASFAVGSASILGSPKDSLALNQQVRKFNQMISNWKVDYIQKSVFMISIGMEDYYNFTKNNPNAEVSAQQAFVTSVTNRFKSDINLLYSSGASKFVVHLLAPLGCLPIARQEFKTGNNCYEKLNDLAKQHNAKIGPILNEMAETKPDFQFTVFDFYNVILRRTQRNMNYRFSVTNISCCGVGTHYAYGCGLPNVHSKLCEYQRSYLYFDARHNTEKAQEAFAHLIFGADPNVIQPMNVRELMVYPVNEPMREFWEDPMDEKLSLVQY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MECSSVSVLGIL ---CCCCHHHHHHHH	30.03	28011693
7	Phosphorylation	-MECSSVSVLGILLV -CCCCHHHHHHHHHH	17.36	28011693
161	N-linked_Glycosylation	IGMEDYYNFTKNNPN ECHHHHHCCCCCCCC	31.70	-
280	N-linked_Glycosylation	NYRFSVTNISCCGVG CCCEEEEEEECCCCC	23.24	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GDL20_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GDL20_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GDL20_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of GDL20_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.