| UniProt ID | FUT1_HUMAN | |
|---|---|---|
| UniProt AC | P19526 | |
| Protein Name | Galactoside 2-alpha-L-fucosyltransferase 1 | |
| Gene Name | FUT1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 365 | |
| Subcellular Localization |
Golgi apparatus, Golgi stack membrane Single-pass type II membrane protein. Membrane-bound form in trans cisternae of Golgi. |
|
| Protein Description | Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Gal-beta-) called the H antigen which is an essential substrate for the final step in the soluble A and B antigen synthesis pathway.. | |
| Protein Sequence | MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 65 | N-linked_Glycosylation | PGTAMGPNASSSCPQ CCCCCCCCCCCCCCC | 46.88 | UniProtKB CARBOHYD | |
| 224 | Phosphorylation | VHVRRGDYLQVMPQR EEEECCCEEEECCCC | 11.23 | 22817900 | |
| 327 | N-linked_Glycosylation | GDTVYLANFTLPDSE CCEEEEEECCCCCHH | 28.04 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FUT1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FUT1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FUT1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GL8D2_HUMAN | GLT8D2 | physical | 28514442 | |
| CGAT2_HUMAN | CSGALNACT2 | physical | 28514442 | |
| NDUS4_HUMAN | NDUFS4 | physical | 28514442 | |
| NDUB8_HUMAN | NDUFB8 | physical | 28514442 | |
| NDUB6_HUMAN | NDUFB6 | physical | 28514442 | |
| HTRA1_HUMAN | HTRA1 | physical | 28514442 | |
| SL9A1_HUMAN | SLC9A1 | physical | 28514442 | |
| GLBL2_HUMAN | GLB1L2 | physical | 28514442 | |
| CGT_HUMAN | UGT8 | physical | 28514442 | |
| NDUB5_HUMAN | NDUFB5 | physical | 28514442 | |
| NU5M_HUMAN | ND5 | physical | 28514442 | |
| PIGB_HUMAN | PIGB | physical | 28514442 | |
| UD3A2_HUMAN | UGT3A2 | physical | 28514442 | |
| NDUB9_HUMAN | NDUFB9 | physical | 28514442 | |
| GOLI4_HUMAN | GOLIM4 | physical | 28514442 | |
| NDUA7_HUMAN | NDUFA7 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
