| UniProt ID | COQ4_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y3A0 | |
| Protein Name | Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03111} | |
| Gene Name | COQ4 {ECO:0000255|HAMAP-Rule:MF_03111} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 265 | |
| Subcellular Localization |
Isoform 1: Mitochondrion inner membrane Peripheral membrane protein Matrix side. |
|
| Protein Description | Component of the coenzyme Q biosynthetic pathway. May play a role in organizing a multi-subunit COQ enzyme complex required for coenzyme Q biosynthesis. Required for steady-state levels of other COQ polypeptides.. | |
| Protein Sequence | MATLLRPVLRRLCGLPGLQRPAAEMPLRARSDGAGPLYSHHLPTSPLQKGLLAAGSAAMALYNPYRHDMVAVLGETTGHRTLKVLRDQMRRDPEGAQILQERPRISTSTLDLGKLQSLPEGSLGREYLRFLDVNRVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNILGEIVVKWFEAVQTGLPMCILGAFFGPIRLGAQSLQVLVSELIPWAVQNGRRAPCVLNLYYERRWEQSLRALREELGITAPPMHVQGLA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 90 (in isoform 2) | Ubiquitination | - | 33.93 | 21906983 | |
| 107 | Phosphorylation | QERPRISTSTLDLGK HHCCCCCCCCCCHHH | 24.29 | 23186163 | |
| 108 | Phosphorylation | ERPRISTSTLDLGKL HCCCCCCCCCCHHHH | 21.85 | 26741492 | |
| 114 | Ubiquitination | TSTLDLGKLQSLPEG CCCCCHHHHCCCCCC | 51.13 | 21906983 | |
| 114 (in isoform 1) | Ubiquitination | - | 51.13 | 21906983 | |
| 127 | Phosphorylation | EGSLGREYLRFLDVN CCCCCHHHHHHHCCC | 11.21 | 30576142 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COQ4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COQ4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COQ4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| COQ5_HUMAN | COQ5 | physical | 25152161 | |
| COQ4_HUMAN | COQ4 | physical | 27499296 | |
| COQ7_HUMAN | COQ7 | physical | 27499296 | |
| COQ5_HUMAN | COQ5 | physical | 27499296 | |
| COQ9_HUMAN | COQ9 | physical | 27499296 | |
| COQ3_HUMAN | COQ3 | physical | 27499296 | |
| COQ6_HUMAN | COQ6 | physical | 27499296 | |
| RM01_HUMAN | MRPL1 | physical | 27499296 | |
| RT16_HUMAN | MRPS16 | physical | 27499296 | |
| CHCH2_HUMAN | CHCHD2 | physical | 27499296 | |
| ECH1_HUMAN | ECH1 | physical | 27499296 | |
| RM23_HUMAN | MRPL23 | physical | 27499296 | |
| PDIP2_HUMAN | POLDIP2 | physical | 27499296 | |
| RT35_HUMAN | MRPS35 | physical | 27499296 | |
| RM13_HUMAN | MRPL13 | physical | 27499296 | |
| RT15_HUMAN | MRPS15 | physical | 27499296 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 616276 | Coenzyme Q10 deficiency, primary, 7 (COQ10D7) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
