UniProt ID | CO8A1_HUMAN | |
---|---|---|
UniProt AC | P27658 | |
Protein Name | Collagen alpha-1(VIII) chain | |
Gene Name | COL8A1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 744 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix, basement membrane. | |
Protein Description | Macromolecular component of the subendothelium. Major component of the Descemet's membrane (basement membrane) of corneal endothelial cells. Also component of the endothelia of blood vessels. Necessary for migration and proliferation of vascular smooth muscle cells and thus, has a potential role in the maintenance of vessel wall integrity and structure, in particular in atherogenesis.; Vastatin, the C-terminal fragment comprising the NC1 domain, inhibits aortic endothelial cell proliferation and causes cell apoptosis.. | |
Protein Sequence | MAVLPGPLQLLGVLLTISLSSIRLIQAGAYYGIKPLPPQIPPQMPPQIPQYQPLGQQVPHMPLAKDGLAMGKEMPHLQYGKEYPHLPQYMKEIQPAPRMGKEAVPKKGKEIPLASLRGEQGPRGEPGPRGPPGPPGLPGHGIPGIKGKPGPQGYPGVGKPGMPGMPGKPGAMGMPGAKGEIGQKGEIGPMGIPGPQGPPGPHGLPGIGKPGGPGLPGQPGPKGDRGPKGLPGPQGLRGPKGDKGFGMPGAPGVKGPPGMHGPPGPVGLPGVGKPGVTGFPGPQGPLGKPGAPGEPGPQGPIGVPGVQGPPGIPGIGKPGQDGIPGQPGFPGGKGEQGLPGLPGPPGLPGIGKPGFPGPKGDRGMGGVPGALGPRGEKGPIGAPGIGGPPGEPGLPGIPGPMGPPGAIGFPGPKGEGGIVGPQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGQKGVPGLPGVPGLLGPKGEPGIPGDQGLQGPPGIPGIGGPSGPIGPPGIPGPKGEPGLPGPPGFPGIGKPGVAGLHGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
18 | Phosphorylation | LGVLLTISLSSIRLI HHHHHHHCHHHHHHH | 19.57 | 26546556 | |
20 | Phosphorylation | VLLTISLSSIRLIQA HHHHHCHHHHHHHHC | 19.54 | 30301811 | |
21 | Phosphorylation | LLTISLSSIRLIQAG HHHHCHHHHHHHHCC | 19.61 | 25954137 | |
115 | Phosphorylation | GKEIPLASLRGEQGP CCCCCHHHHCCCCCC | 26.70 | 24719451 | |
178 | Acetylation | AMGMPGAKGEIGQKG CCCCCCCCCCCCCCC | 64.09 | 7461981 | |
577 | O-linked_Glycosylation | PPAVMPPTPPPQGEY CCCCCCCCCCCCCCC | 42.42 | OGP | |
613 | Phosphorylation | GKNGGPAYEMPAFTA CCCCCCCCCCCCEEE | 18.85 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CO8A1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CO8A1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CO8A1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KLH12_HUMAN | KLHL12 | physical | 16189514 | |
KR412_HUMAN | KRTAP4-12 | physical | 16189514 | |
FBLN4_HUMAN | EFEMP2 | physical | 16189514 | |
CO8A2_HUMAN | COL8A2 | physical | 9705353 | |
ATL4_HUMAN | ADAMTSL4 | physical | 19060904 | |
REL_HUMAN | REL | physical | 25416956 | |
SP4_HUMAN | SP4 | physical | 25416956 | |
CREB5_HUMAN | CREB5 | physical | 25416956 | |
VAC14_HUMAN | VAC14 | physical | 25416956 | |
KRA92_HUMAN | KRTAP9-2 | physical | 25416956 | |
K1C40_HUMAN | KRT40 | physical | 25416956 | |
KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
INCA1_HUMAN | INCA1 | physical | 25416956 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 | |
KR261_HUMAN | KRTAP26-1 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...