UniProt ID | B2L14_HUMAN | |
---|---|---|
UniProt AC | Q9BZR8 | |
Protein Name | Apoptosis facilitator Bcl-2-like protein 14 | |
Gene Name | BCL2L14 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 327 | |
Subcellular Localization |
Cytoplasm . Isoform 1: Cytoplasm, cytosol. Diffusely distributed throughout the cytosol. Isoform 2: Endomembrane system. Predominantly localized to cytosolic organelles. |
|
Protein Description | Plays a role in apoptosis.. | |
Protein Sequence | MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
38 | Phosphorylation | TRHHVFKSTPALFSP HHHHHHCCCCCHHCH | 28.32 | - | |
44 | Phosphorylation | KSTPALFSPKLLRTR CCCCCHHCHHHHHCC | 23.21 | 24670416 | |
50 | Phosphorylation | FSPKLLRTRSLSQRG HCHHHHHCCCCHHCC | 25.28 | 23312004 | |
52 | Phosphorylation | PKLLRTRSLSQRGLG HHHHHCCCCHHCCCC | 31.59 | 23312004 | |
54 | Phosphorylation | LLRTRSLSQRGLGNC HHHCCCCHHCCCCCC | 21.05 | 23312004 | |
62 | Phosphorylation | QRGLGNCSANESWTE HCCCCCCCCCCCCCE | 37.82 | 25693802 | |
66 | Phosphorylation | GNCSANESWTEVSWP CCCCCCCCCCEECCC | 38.82 | 27251275 | |
68 | Phosphorylation | CSANESWTEVSWPCR CCCCCCCCEECCCCC | 35.47 | 27251275 | |
71 | Phosphorylation | NESWTEVSWPCRNSQ CCCCCEECCCCCCCC | 21.04 | 28348404 | |
113 | Phosphorylation | QSTPAKVSAQGQRTL CCCCCEEEECCCEEE | 17.73 | 27135362 | |
125 | Phosphorylation | RTLEYQDSHSQQWSR EEEEECCCCHHHHHH | 14.98 | 27251275 | |
135 | Phosphorylation | QQWSRCLSNVEQCLE HHHHHHHHCHHHHHH | 42.32 | 26657352 | |
152 | Phosphorylation | AVDPKVISIANRVAE CCCHHHHHHHHHHHH | 20.73 | 23927012 | |
183 | Phosphorylation | KSKEIFVTEGLSFQL CCCEEEEECCCEEEE | 17.37 | 29083192 | |
187 | Phosphorylation | IFVTEGLSFQLQGHV EEEECCCEEEEEEEC | 23.08 | 29083192 | |
198 | Phosphorylation | QGHVPVASSSKKDEE EEECCCCCCCCCCHH | 35.06 | 29083192 | |
199 | Phosphorylation | GHVPVASSSKKDEEE EECCCCCCCCCCHHH | 36.12 | 29083192 | |
200 | Phosphorylation | HVPVASSSKKDEEEQ ECCCCCCCCCCHHHH | 41.03 | 29083192 | |
218 | Phosphorylation | KIVELLKYSGDQLER HHHHHHHHCHHHHHH | 20.18 | 26074081 | |
219 | Phosphorylation | IVELLKYSGDQLERK HHHHHHHCHHHHHHH | 34.01 | 26074081 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of B2L14_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of B2L14_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of B2L14_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome of resting human platelets."; Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J.,Schuetz C., Walter U., Gambaryan S., Sickmann A.; J. Proteome Res. 7:526-534(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152, AND MASSSPECTROMETRY. |