UniProt ID | ZN212_HUMAN | |
---|---|---|
UniProt AC | Q9UDV6 | |
Protein Name | Zinc finger protein 212 | |
Gene Name | ZNF212 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 495 | |
Subcellular Localization | Nucleus . | |
Protein Description | May be involved in transcriptional regulation.. | |
Protein Sequence | MAESAPARHRRKRRSTPLTSSTLPSQATEKSSYFQTTEISLWTVVAAIQAVEKKMESQAARLQSLEGRTGTAEKKLADCEKMAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEAPKVSRSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSLKVLGQTEGEAELGTEMLGDLEEEGPGGAHPAGGVMIKQELQYTQEGPADLPGEFSCIAEEQAFLSPEQTELWGGQGSSVLLETGPGDSTLEEPVGSRVPSSSRTVGCPKQKSHRQVQLDQECGQGLKLKKDTSRPYECSECEITFRYKQQLATHLRSHSGWGSCTPEEPEESLRPRPRLKPQTKKAKLHQCDVCLRSFSCKVSLVTHQRCHLQEGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCTECEKSFVQKQHLLQHQKIHQRERGGLALEPGRPNGLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | RHRRKRRSTPLTSST HHHCCCCCCCCCCCC | 38.11 | 25159151 | |
16 | Phosphorylation | HRRKRRSTPLTSSTL HHCCCCCCCCCCCCC | 22.10 | 25159151 | |
19 | Phosphorylation | KRRSTPLTSSTLPSQ CCCCCCCCCCCCCCC | 23.10 | 23312004 | |
20 | Phosphorylation | RRSTPLTSSTLPSQA CCCCCCCCCCCCCCC | 29.07 | 23312004 | |
21 | Phosphorylation | RSTPLTSSTLPSQAT CCCCCCCCCCCCCCC | 28.82 | 23312004 | |
22 | Phosphorylation | STPLTSSTLPSQATE CCCCCCCCCCCCCCC | 42.32 | 23312004 | |
28 | Phosphorylation | STLPSQATEKSSYFQ CCCCCCCCCCCCCCC | 35.99 | - | |
64 | Phosphorylation | SQAARLQSLEGRTGT HHHHHHHHHHCCCCC | 32.74 | - | |
81 | Ubiquitination | KKLADCEKMAVEFGN HHHHHHHHHHHHHHH | 38.19 | - | |
99 | Phosphorylation | GKWAVLGTLLQEYGL HHHHHHHHHHHHHCH | 21.82 | - | |
104 | Phosphorylation | LGTLLQEYGLLQRRL HHHHHHHHCHHHHHH | 10.50 | 22817900 | |
166 | Phosphorylation | EDWQKELYRNVMESN HHHHHHHHHHHHHHC | 10.96 | 23663014 | |
172 | Phosphorylation | LYRNVMESNYETLVS HHHHHHHHCHHHHHE | 26.98 | 23663014 | |
174 | Phosphorylation | RNVMESNYETLVSLK HHHHHHCHHHHHEEE | 21.41 | 23663014 | |
176 | Phosphorylation | VMESNYETLVSLKVL HHHHCHHHHHEEEEC | 23.31 | 23663014 | |
179 | Phosphorylation | SNYETLVSLKVLGQT HCHHHHHEEEECCCC | 26.11 | 23663014 | |
307 | Ubiquitination | QECGQGLKLKKDTSR CCCCCCCCCCCCCCC | 66.15 | - | |
328 | Ubiquitination | CEITFRYKQQLATHL CEEEEEEHHHHHHHH | 27.58 | - | |
407 | Phosphorylation | QHVQERFSPNSLVAL HHHHHHCCCCCEEEC | 29.41 | 21857030 | |
410 | Phosphorylation | QERFSPNSLVALPGH HHHCCCCCEEECCCC | 27.83 | 28348404 | |
435 | Phosphorylation | ICGYCGKSFSHPSDL ECCCCCCCCCCHHHH | 19.77 | - | |
462 | Ubiquitination | YSCTECEKSFVQKQH CCCCHHHHHHHHHHH | 61.93 | - | |
467 | Ubiquitination | CEKSFVQKQHLLQHQ HHHHHHHHHHHHHHH | 34.09 | - | |
475 | Ubiquitination | QHLLQHQKIHQRERG HHHHHHHHHHHHHCC | 39.78 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN212_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN212_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN212_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...