| UniProt ID | RND1_HUMAN | |
|---|---|---|
| UniProt AC | Q92730 | |
| Protein Name | Rho-related GTP-binding protein Rho6 | |
| Gene Name | RND1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 232 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . Cytoplasm, cytoskeleton . |
|
| Protein Description | Lacks intrinsic GTPase activity. Has a low affinity for GDP, and constitutively binds GTP. Controls rearrangements of the actin cytoskeleton. Induces the Rac-dependent neuritic process formation in part by disruption of the cortical actin filaments. Causes the formation of many neuritic processes from the cell body with disruption of the cortical actin filaments.. | |
| Protein Sequence | MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 140 | Phosphorylation | LSTLMELSHQKQAPI HHHHHHHHHCCCCCC | 15.57 | - | |
| 143 | Ubiquitination | LMELSHQKQAPISYE HHHHHHCCCCCCCHH | 42.90 | 29967540 | |
| 182 | Phosphorylation | SIHSIFRTASMLCLN HHHHHHHHHHHHHCC | 16.60 | - | |
| 184 | Phosphorylation | HSIFRTASMLCLNKP HHHHHHHHHHHCCCC | 16.21 | - | |
| 192 | Phosphorylation | MLCLNKPSPLPQKSP HHHCCCCCCCCCCCH | 40.45 | 29083192 | |
| 198 | Phosphorylation | PSPLPQKSPVRSLSK CCCCCCCCHHHHHHH | 24.31 | 29083192 | |
| 212 | Phosphorylation | KRLLHLPSRSELISS HHHHCCCCHHHHHHH | 55.59 | - | |
| 222 | Ubiquitination | ELISSTFKKEKAKSC HHHHHHHCHHHHHCC | 61.17 | 33845483 | |
| 229 | Methylation | KKEKAKSCSIM---- CHHHHHCCCCC---- | 2.93 | - | |
| 229 | Geranylgeranylation | KKEKAKSCSIM---- CHHHHHCCCCC---- | 2.93 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RND1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RND1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RND1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PLXB2_HUMAN | PLXNB2 | physical | 12730235 | |
| UBX11_HUMAN | UBXN11 | physical | 11940653 | |
| RHG05_HUMAN | ARHGAP5 | physical | 12842009 | |
| GRB7_HUMAN | GRB7 | physical | 10664463 | |
| PSB5_HUMAN | PSMB5 | physical | 20980621 | |
| PKHG5_HUMAN | PLEKHG5 | physical | 22807448 | |
| PLXB1_HUMAN | PLXNB1 | physical | 22807448 | |
| RGS14_HUMAN | RGS14 | physical | 22807448 | |
| RHG35_HUMAN | ARHGAP35 | physical | 22807448 | |
| CR3L2_HUMAN | CREB3L2 | physical | 18255255 | |
| ID3_HUMAN | ID3 | physical | 18255255 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...