UniProt ID | YN97B_YEAST | |
---|---|---|
UniProt AC | P0C271 | |
Protein Name | Uncharacterized protein YNL097C-B | |
Gene Name | YNL097C-B | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 40 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MTAKTKQSWNKGIWENGKQGSHQQTFLPKIWVNIYSTPTS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YN97B_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YN97B_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YN97B_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YN97B_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UTP13_YEAST | UTP13 | genetic | 27708008 | |
STU1_YEAST | STU1 | genetic | 27708008 | |
AAR2_YEAST | AAR2 | genetic | 27708008 | |
PRP6_YEAST | PRP6 | genetic | 27708008 | |
POP7_YEAST | POP7 | genetic | 27708008 | |
CDC37_YEAST | CDC37 | genetic | 27708008 | |
ERF3_YEAST | SUP35 | genetic | 27708008 | |
GPI11_YEAST | GPI11 | genetic | 27708008 | |
RSP5_YEAST | RSP5 | genetic | 27708008 | |
GNA1_YEAST | GNA1 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
YPT1_YEAST | YPT1 | genetic | 27708008 | |
ACT_YEAST | ACT1 | genetic | 27708008 | |
PSB7_YEAST | PRE4 | genetic | 27708008 | |
TAF1_YEAST | TAF1 | genetic | 27708008 | |
CDC12_YEAST | CDC12 | genetic | 27708008 | |
ARP4_YEAST | ARP4 | genetic | 27708008 | |
IF2A_YEAST | SUI2 | genetic | 27708008 | |
YJ9I_YEAST | YJR141W | genetic | 27708008 | |
CDC25_YEAST | CDC25 | genetic | 27708008 | |
AFG2_YEAST | AFG2 | genetic | 27708008 | |
ERB1_YEAST | ERB1 | genetic | 27708008 | |
NOG2_YEAST | NOG2 | genetic | 27708008 | |
RRS1_YEAST | RRS1 | genetic | 27708008 | |
RPA1_YEAST | RPA190 | genetic | 27708008 | |
TFC8_YEAST | TFC8 | genetic | 27708008 | |
IF6_YEAST | TIF6 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...