UniProt ID | UBE2Z_HUMAN | |
---|---|---|
UniProt AC | Q9H832 | |
Protein Name | Ubiquitin-conjugating enzyme E2 Z | |
Gene Name | UBE2Z | |
Organism | Homo sapiens (Human). | |
Sequence Length | 354 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity). Specific substrate for UBA6, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation.. | |
Protein Sequence | MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGSGLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
58 (in isoform 2) | Ubiquitination | - | 32.62 | 21890473 | |
110 | Phosphorylation | RIKRDIMSIYKEPPP HHHHHHHHHHCCCCC | 24.09 | 28348404 | |
113 (in isoform 1) | Ubiquitination | - | 63.17 | 21890473 | |
113 | Ubiquitination | RDIMSIYKEPPPGMF HHHHHHHCCCCCCEE | 63.17 | 21906983 | |
125 | Phosphorylation | GMFVVPDTVDMTKIH CEEECCCCCCCCEEE | 16.60 | 20068231 | |
129 | Phosphorylation | VPDTVDMTKIHALIT CCCCCCCCEEEEEEE | 23.53 | 20068231 | |
166 (in isoform 1) | Ubiquitination | - | 33.54 | 21890473 | |
166 | Malonylation | PIHPPRVKLMTTGNN CCCCCCEEEEECCCC | 33.54 | 26320211 | |
166 | Ubiquitination | PIHPPRVKLMTTGNN CCCCCCEEEEECCCC | 33.54 | 23000965 | |
174 | Phosphorylation | LMTTGNNTVRFNPNF EEECCCCEEECCCCC | 19.63 | 20068231 | |
196 (in isoform 2) | Ubiquitination | - | 32.88 | 21890473 | |
238 | Acetylation | ERHPGDSKNYNECIR CCCCCCCCCHHHHHH | 69.09 | 26051181 | |
238 | Ubiquitination | ERHPGDSKNYNECIR CCCCCCCCCHHHHHH | 69.09 | 21963094 | |
240 | Phosphorylation | HPGDSKNYNECIRHE CCCCCCCHHHHHHHC | 18.97 | 28152594 | |
260 | Ubiquitination | VCDMMEGKCPCPEPL HHHHHCCCCCCCHHC | 23.00 | 21963094 | |
268 | Methylation | CPCPEPLRGVMEKSF CCCCHHCCHHHHHHH | 46.50 | 115919397 | |
273 | Ubiquitination | PLRGVMEKSFLEYYD HCCHHHHHHHHHHEE | 28.54 | 21963094 | |
287 | Ubiquitination | DFYEVACKDRLHLQG EHHHHHCCCCCEECC | 35.82 | 32015554 | |
304 | 2-Hydroxyisobutyrylation | MQDPFGEKRGHFDYQ CCCCCCCCCCCCCHH | 65.15 | - | |
304 | Acetylation | MQDPFGEKRGHFDYQ CCCCCCCCCCCCCHH | 65.15 | 23954790 | |
304 (in isoform 1) | Ubiquitination | - | 65.15 | 21890473 | |
304 | Ubiquitination | MQDPFGEKRGHFDYQ CCCCCCCCCCCCCHH | 65.15 | 23000965 | |
337 | Phosphorylation | NENAEMDSDSSSSGT HCCCCCCCCCCCCCC | 37.77 | 30278072 | |
339 | Phosphorylation | NAEMDSDSSSSGTET CCCCCCCCCCCCCCC | 35.75 | 30278072 | |
340 | Phosphorylation | AEMDSDSSSSGTETD CCCCCCCCCCCCCCC | 33.25 | 30278072 | |
341 | Phosphorylation | EMDSDSSSSGTETDL CCCCCCCCCCCCCCC | 36.42 | 24043423 | |
342 | Phosphorylation | MDSDSSSSGTETDLH CCCCCCCCCCCCCCC | 52.24 | 23911959 | |
344 | Phosphorylation | SDSSSSGTETDLHGS CCCCCCCCCCCCCCC | 37.35 | 24043423 | |
346 | Phosphorylation | SSSSGTETDLHGSLR CCCCCCCCCCCCCCC | 43.64 | 25072903 | |
351 | Phosphorylation | TETDLHGSLRV---- CCCCCCCCCCC---- | 11.40 | 25850435 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBE2Z_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBE2Z_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBE2Z_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PKHF2_HUMAN | PLEKHF2 | physical | 16189514 | |
R144B_HUMAN | RNF144B | physical | 19690564 | |
RN103_HUMAN | RNF103 | physical | 19690564 | |
MDM2_HUMAN | MDM2 | physical | 19690564 | |
RNF41_HUMAN | RNF41 | physical | 19690564 | |
GOLI_HUMAN | RNF130 | physical | 19690564 | |
RN150_HUMAN | RNF150 | physical | 19690564 | |
HLTF_HUMAN | HLTF | physical | 19690564 | |
SYVN1_HUMAN | SYVN1 | physical | 19690564 | |
RN139_HUMAN | RNF139 | physical | 19690564 | |
LNX2_HUMAN | LNX2 | physical | 19549727 | |
RNF5_HUMAN | RNF5 | physical | 19549727 | |
TRAIP_HUMAN | TRAIP | physical | 19549727 | |
DZIP3_HUMAN | DZIP3 | physical | 19549727 | |
RAPSN_HUMAN | RAPSN | physical | 19549727 | |
TRI27_HUMAN | TRIM27 | physical | 19549727 | |
RN166_HUMAN | RNF166 | physical | 19549727 | |
TRI46_HUMAN | TRIM46 | physical | 19549727 | |
UBR1_HUMAN | UBR1 | physical | 21816346 | |
UBR3_HUMAN | UBR3 | physical | 21816346 | |
UBA6_HUMAN | UBA6 | physical | 20975683 | |
XPO1_HUMAN | XPO1 | physical | 22939629 | |
WDR12_HUMAN | WDR12 | physical | 22939629 | |
TRI65_HUMAN | TRIM65 | physical | 19549727 | |
HMBX1_HUMAN | HMBOX1 | physical | 25416956 | |
KAD8_HUMAN | AK8 | physical | 25416956 | |
UBA1_HUMAN | UBA1 | physical | 25768649 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...