PIP15_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PIP15_ARATH
• UniProt AC: Q8LAA6
• Protein Name: Probable aquaporin PIP1-5
• Gene Name: PIP1-5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 287
• Subcellular Localization: Cell membrane ; Multi-pass membrane protein .
• Protein Description: Aquaporins facilitate the transport of water and small neutral solutes across cell membranes..
• Protein Sequence: MEGKEEDVNVGANKFPERQPIGTAAQTESKDYKEPPPAPFFEPGELKSWSFYRAGIAEFIATFLFLYVTVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRALFYIVMQCLGAICGAGVVKGFQPGLYQTNGGGANVVAHGYTKGSGLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKDHAWDDHWIFWVGPFIGAALAALYHQIVIRAIPFKSKT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Sulfoxidation	-------MEGKEEDV -------CCCCCCCC	16.10	25693801
1	Acetylation	-------MEGKEEDV -------CCCCCCCC	16.10	-
285	Phosphorylation	IRAIPFKSKT----- HHHCCCCCCC-----	41.74	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PIP15_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PIP15_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PIP15_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NAC89_ARATH	NAC089	physical	21798944
PIP27_ARATH	PIP3	physical	21798944
PIP25_ARATH	PIP2;5	physical	24833385
PIP15_ARATH	PIP1;5	physical	24833385
UTR2_ARATH	UTR2	physical	24833385
HHP2_ARATH	HHP2	physical	24833385
HHP4_ARATH	HHP4	physical	24833385
UBC34_ARATH	UBC34	physical	24833385
POP3_ARATH	HS1	physical	24833385
UTR3_ARATH	UTR3	physical	24833385
PIP23_ARATH	RD28	physical	24833385
PIP22_ARATH	PIP2B	physical	24833385
TPIS_ARATH	TPI	physical	24833385
PIP21_ARATH	PIP2A	physical	24833385
AGP27_ARATH	AGP27	physical	24833385
FUT10_ARATH	FUT10	physical	24833385
CP21D_ARATH	AT3G66654	physical	24833385
SPCS1_ARATH	AT2G22425	physical	24833385
BETL2_ARATH	AT1G29060	physical	24833385
BET12_ARATH	ATBET12	physical	24833385
TBL18_ARATH	TBL18	physical	24833385
APRL4_ARATH	APRL4	physical	24833385
PDI52_ARATH	PDIL5-2	physical	24833385
TRXH7_ARATH	TH7	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.