| UniProt ID | UTR3_ARATH | |
|---|---|---|
| UniProt AC | Q9M9S6 | |
| Protein Name | UDP-galactose/UDP-glucose transporter 3 {ECO:0000303|PubMed:12042319} | |
| Gene Name | UTR3 {ECO:0000303|PubMed:12042319} | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 331 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Golgi apparatus membrane Multi-pass membrane protein . |
|
| Protein Description | Essential sugar transporter required for the transport of UDP-glucose from the cytoplasm into the Golgi and the endoplasmic reticulum. Essential for pollen development and involved in embryo sac progress.. | |
| Protein Sequence | MESHGSGLRRVLLLSFCVAGIWAAYIYQGILQETLSTKKFGEDGKRFEHLAFLNLAQNVICLVWSYIMIKLWSNGGSGGAPWWTYWSAGITNTIGPAMGIEALKYISYPAQVLAKSSKMIPVMLMGSLVYGIRYTLPEYLCTFLVAGGVSMFALLKTSSKTISKLAHPNAPLGYGLCFLNLAFDGFTNATQDSITARYPKTNAWDIMLGMNLWGTIYNMVYMFGLPHGSGFEAVQFCKQHPEAAWDILMYCLCGAVGQNFIFLTISRFGSLANTTITTTRKFVSIVVSSVLSGNPLSSKQWGCVSMVFGGLSYQIYLKWRKLQRMQKKKKA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of UTR3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UTR3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UTR3_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UTR3_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NIP11_ARATH | NLM1 | physical | 21798944 | |
| NAC89_ARATH | NAC089 | physical | 21798944 | |
| VAP11_ARATH | VAP | physical | 21798944 | |
| Y4645_ARATH | AT4G26450 | physical | 21798944 | |
| NUP35_ARATH | AT3G16310 | physical | 21798944 | |
| FAO3_ARATH | FAO3 | physical | 24833385 | |
| UTR2_ARATH | UTR2 | physical | 24833385 | |
| HHP4_ARATH | HHP4 | physical | 24833385 | |
| UBC34_ARATH | UBC34 | physical | 24833385 | |
| ACBP6_ARATH | ACBP6 | physical | 24833385 | |
| UTR3_ARATH | UTR3 | physical | 24833385 | |
| CNIH1_ARATH | AT3G12180 | physical | 24833385 | |
| CP21D_ARATH | AT3G66654 | physical | 24833385 | |
| SPCS1_ARATH | AT2G22425 | physical | 24833385 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
