AGP27_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AGP27_ARATH
• UniProt AC: Q9SQT9
• Protein Name: Classical arabinogalactan protein 27
• Gene Name: AGP27
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 125
• Subcellular Localization: Cell membrane ; Lipid-anchor, GPI-anchor .
• Protein Description: Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death..
• Protein Sequence: MASSILLTLITFIFLSSLSLSSPTTNTIPSSQTISPSEEKISPEIAPLLPSPAVSSTQTIPSSSTLPEPENDDVSADPDPAFAPSASPPASSLASLSSQAPGVFIYFVFAAVYCFSLRLLAVSAI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
98	GPI-anchor	SSLASLSSQAPGVFI HHHHHHHCCCCHHHH	35.34	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AGP27_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AGP27_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AGP27_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AUX1_ARATH	AUX1	physical	21423366
SUC9_ARATH	SUC9	physical	21423366
RC21_ARATH	AT1G57550	physical	21423366
GCR1_ARATH	GCR1	physical	21423366
WAXS6_ARATH	AT5G55330	physical	21423366

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.