UniProt ID | AGP27_ARATH | |
---|---|---|
UniProt AC | Q9SQT9 | |
Protein Name | Classical arabinogalactan protein 27 | |
Gene Name | AGP27 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 125 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . |
|
Protein Description | Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.. | |
Protein Sequence | MASSILLTLITFIFLSSLSLSSPTTNTIPSSQTISPSEEKISPEIAPLLPSPAVSSTQTIPSSSTLPEPENDDVSADPDPAFAPSASPPASSLASLSSQAPGVFIYFVFAAVYCFSLRLLAVSAI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
98 | GPI-anchor | SSLASLSSQAPGVFI HHHHHHHCCCCHHHH | 35.34 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AGP27_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AGP27_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AGP27_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AUX1_ARATH | AUX1 | physical | 21423366 | |
SUC9_ARATH | SUC9 | physical | 21423366 | |
RC21_ARATH | AT1G57550 | physical | 21423366 | |
GCR1_ARATH | GCR1 | physical | 21423366 | |
WAXS6_ARATH | AT5G55330 | physical | 21423366 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...