AUX1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AUX1_ARATH
• UniProt AC: Q96247
• Protein Name: Auxin transporter protein 1
• Gene Name: AUX1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 485
• Subcellular Localization: Cell membrane ; Multi-pass membrane protein . In S2 columella cells, a dynamic cytoplasmic to membrane localization seems to occur during early stage of gravity signal transduction. In roots protophloem cells, asymmetric repartition in the upper plas
• Protein Description: Carrier protein involved in proton-driven auxin influx. Mediates the formation of auxin gradient from developing leaves (site of auxin biosynthesis) to tips by contributing to the loading of auxin in vascular tissues and facilitating acropetal (base to tip) auxin transport within inner tissues of the root apex, and basipetal (tip to base) auxin transport within outer tissues of the root apex. Unloads auxin from the mature phloem to deliver the hormone to the root meristem via the protophloem cell files. Coordinated subcellular localization of AUX1 is regulated by a brefeldin A-sensitive (BFA) vesicle trafficking process. Involved in lateral root formation, trichoblast polarization and root hair elongation. Required for gravitropism and thigmotropism, especially in roots, by modulating responses to auxin, ethylene and cytokinins such as benzyladenine (BA). Needed for ammonium-mediated root-growth inhibition. Confers sensitivity to the herbicide 2,4-dichlorophenoxyacetic acid (2,4-D, auxin analog), and to polar auxin transport inhibitors such as N-1-naphthylphthalamic acid (NPA) and 2,3,5-triiodobenzoic acid (TIBA)..
• Protein Sequence: MSEGVEAIVANDNGTDQVNGNRTGKDNEEHDGSTGSNLSNFLWHGGSVWDAWFSCASNQVAQVLLTLPYSFSQLGMLSGIVLQIFYGLLGSWTAYLISVLYVEYRARKEKEGKSFKNHVIQWFEVLDGLLGSYWKALGLAFNCTFLLFGSVIQLIACASNIYYINDHLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYLAIASIIHGQAEGVKHSGPTKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPQKFKYIYLMATLYVFTLTIPSAAAVYWAFGDALLDHSNAFSLMPKNAWRDAAVILMLIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSLAHMLTYRSASARQNAAEKPPFFMPSWTAMYVLNAFVVVWVLIVGFGFGGWASVTNFVRQVDTFGLFAKCYQCKPAAAAAHAPVSALHHRL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
78	Phosphorylation	FSQLGMLSGIVLQIF HHHHHHHHHHHHHHH	19.99	28011693

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AUX1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AUX1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AUX1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
Y5659_ARATH	LRR1	physical	21423366
HHP2_ARATH	HHP2	physical	24833385
HHP4_ARATH	HHP4	physical	24833385
UBC32_ARATH	UBC32	physical	24833385
UBC34_ARATH	UBC34	physical	24833385
ACBP6_ARATH	ACBP6	physical	24833385
FACE2_ARATH	FACE2	physical	24833385
AGP27_ARATH	AGP27	physical	24833385
AB12I_ARATH	AT3G21580	physical	24833385
CP21D_ARATH	AT3G66654	physical	24833385
PAM74_ARATH	AT5G59650	physical	24833385
BET12_ARATH	ATBET12	physical	24833385
TBL18_ARATH	TBL18	physical	24833385
MMGT_ARATH	AT5G03345	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.