RC21_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RC21_ARATH
• UniProt AC: Q9FE70
• Protein Name: UPF0057 membrane protein At1g57550
• Gene Name: At1g57550
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 52
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MGSFLEVLCAIFIPPVGVFLRYGLGLEFWVCLLLTLFAFIPGLIYAIYVLTK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RC21_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RC21_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RC21_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RC21_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RC21_ARATH	AT1G57550	physical	21423366
GCR1_ARATH	GCR1	physical	21423366
HHP2_ARATH	HHP2	physical	24833385
HHP4_ARATH	HHP4	physical	24833385
UBC32_ARATH	UBC32	physical	24833385
UBC34_ARATH	UBC34	physical	24833385
CNIH1_ARATH	AT3G12180	physical	24833385
MSBP2_ARATH	MAPR3	physical	24833385
CP21D_ARATH	AT3G66654	physical	24833385
BET12_ARATH	ATBET12	physical	24833385
TBL18_ARATH	TBL18	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.