dbPTM

SUC9_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SUC9_ARATH
UniProt AC	Q9FG00
Protein Name	Sucrose transport protein SUC9
Gene Name	SUC9
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	491
Subcellular Localization	Cell membrane Multi-pass membrane protein .
Protein Description	High-affinity sucrose transporter. Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). Can also transport a wide range of glucosides, such as helicin, salicin, arbutin, maltose, fraxin, esculin, uranose, alpha-methylglucoside, alpha-phenylglucoside and beta-phenylglucoside. Plays a role in flowering time transition delay..
Protein Sequence	MSDIQAKEDAAPVDRQSSSSVVVPDEPSPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPISGLLVQPTVGYFSDRCKSRFGRRRPFIATGALLVALAVILIGFAADFGHTMGDKLDEAVKIRAVGFFVVGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAIFSFFMAVGNVLGYAAGSYTNLHKIFPFTVTKACDIYCANLKSCFIISITLLIVLTIIALWYVEDKQWSPNADSDNEKTPFFGEIFGAFKVMKRPMWMLLAVTALNWIAWFPFLLYDTDWMGREVYGGDSAGDDKMKKLYNHGIQVGSLGLMLNSIVLGVMSLVIGVISKKIGAKRLWGAVNIILAVCLAMTVLVTKKAEEHRKIAGRMALPTNAIRDGALSLFAILGIPLAITFSIPFALASIISSSSGAGQGLSLGVLNMAIVIPQMIVSFGVGPIDALFGGGNLPGFVVGAIAALISSVVALTVLP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
17	Phosphorylation	AAPVDRQSSSSVVVP CCCCCCCCCCCEECC	32.84	-
308	Phosphorylation	DWMGREVYGGDSAGD CCCCCCCCCCCCCCC	15.61	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SUC9_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SUC9_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SUC9_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SUC9_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SUC9_ARATH

Related Literatures of Post-Translational Modification