| UniProt ID | PIP23_ARATH | |
|---|---|---|
| UniProt AC | P30302 | |
| Protein Name | Aquaporin PIP2-3 | |
| Gene Name | PIP2-3 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 285 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein . |
|
| Protein Description | Water channel required to facilitate the transport of water across cell membrane; mercury-insensitive.. | |
| Protein Sequence | MAKDVEGPDGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSHYVNYGGGANFLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNKSKPWDDHWIFWVGPFIGATIAAFYHQFVLRASGSKSLGSFRSAANV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MAKDVEGP -------CCCCCCCC | 10.63 | - | |
| 2 | Acetylation | ------MAKDVEGPD ------CCCCCCCCC | 19.43 | - | |
| 13 | Phosphorylation | EGPDGFQTRDYEDPP CCCCCCCCCCCCCCC | 24.21 | 19880383 | |
| 275 | Phosphorylation | LRASGSKSLGSFRSA HHHCCCCCCCCHHHC | 39.39 | 23776212 | |
| 278 | Phosphorylation | SGSKSLGSFRSAANV CCCCCCCCHHHCCCC | 23.84 | 30291188 | |
| 281 | Phosphorylation | KSLGSFRSAANV--- CCCCCHHHCCCC--- | 29.71 | 30291188 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PIP23_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIP23_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIP23_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PIP15_ARATH | PIP1;5 | physical | 21798944 | |
| PIP14_ARATH | PIP1;4 | physical | 21798944 | |
| PIP11_ARATH | PIP1A | physical | 21798944 | |
| PIP25_ARATH | PIP2;5 | physical | 21798944 | |
| PIP27_ARATH | PIP3 | physical | 21798944 | |
| NIP11_ARATH | NLM1 | physical | 21798944 | |
| NUP35_ARATH | AT3G16310 | physical | 21798944 | |
| VAP11_ARATH | VAP | physical | 21798944 | |
| PAM74_ARATH | AT5G59650 | physical | 21423366 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Phosphoproteomics of the Arabidopsis plasma membrane and a newphosphorylation site database."; Nuehse T.S., Stensballe A., Jensen O.N., Peck S.C.; Plant Cell 16:2394-2405(2004). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-278 AND SER-281, ANDMASS SPECTROMETRY. | |
