UniProt ID | PAU2_YEAST | |
---|---|---|
UniProt AC | P32612 | |
Protein Name | Seripauperin-2 | |
Gene Name | PAU2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 120 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYSFQAAHPTETYPIEVAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTIAN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PAU2_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAU2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAU2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAU2_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GLO3_YEAST | GLO3 | genetic | 23891562 | |
FEN1_YEAST | RAD27 | genetic | 23891562 | |
SNF5_YEAST | SNF5 | genetic | 27708008 | |
NPL4_YEAST | NPL4 | genetic | 27708008 | |
AIM4_YEAST | AIM4 | genetic | 27708008 | |
PYC2_YEAST | PYC2 | genetic | 27708008 | |
ELO2_YEAST | ELO2 | genetic | 27708008 | |
RLA1_YEAST | RPP1A | genetic | 27708008 | |
ODO2_YEAST | KGD2 | genetic | 27708008 | |
DHAS_YEAST | HOM2 | genetic | 27708008 | |
H2A1_YEAST | HTA1 | genetic | 27708008 | |
GCN1_YEAST | GCN1 | genetic | 27708008 | |
MDM34_YEAST | MDM34 | genetic | 27708008 | |
DHOM_YEAST | HOM6 | genetic | 27708008 | |
YPT6_YEAST | YPT6 | genetic | 27708008 | |
FKS1_YEAST | FKS1 | genetic | 27708008 | |
ROM2_YEAST | ROM2 | genetic | 27708008 | |
ZRC1_YEAST | ZRC1 | genetic | 27708008 | |
TPM1_YEAST | TPM1 | genetic | 27708008 | |
EXO1_YEAST | EXO1 | genetic | 27708008 | |
VPS5_YEAST | VPS5 | genetic | 27708008 | |
SGF11_YEAST | SGF11 | genetic | 27708008 | |
GGPPS_YEAST | BTS1 | genetic | 27708008 | |
AIM44_YEAST | AIM44 | genetic | 27708008 | |
BRR1_YEAST | BRR1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...