UniProt ID | PAU20_YEAST | |
---|---|---|
UniProt AC | Q08322 | |
Protein Name | Seripauperin-20 | |
Gene Name | PAU20 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 120 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MVKLTSIAAGVAAIAAGASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVAEAVFNYGDFTTMLTGISPDQVTRMITGVPWYSTRLKPAISKALSKDGIYTIAN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PAU20_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAU20_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAU20_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAU20_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ATP10_YEAST | ATP10 | genetic | 27708008 | |
YP117_YEAST | YPR117W | genetic | 27708008 | |
SLU7_YEAST | SLU7 | genetic | 27708008 | |
PRS7_YEAST | RPT1 | genetic | 27708008 | |
GPI15_YEAST | GPI15 | genetic | 27708008 | |
RPC6_YEAST | RPC34 | genetic | 27708008 | |
PSB5_YEAST | PRE2 | genetic | 27708008 | |
SNF5_YEAST | SNF5 | genetic | 27708008 | |
ATG1_YEAST | ATG1 | genetic | 27708008 | |
RME1_YEAST | RME1 | genetic | 27708008 | |
TNA1_YEAST | TNA1 | genetic | 27708008 | |
KC11_YEAST | YCK1 | genetic | 27708008 | |
AIM18_YEAST | AIM18 | genetic | 27708008 | |
ILM1_YEAST | ILM1 | genetic | 27708008 | |
DHOM_YEAST | HOM6 | genetic | 27708008 | |
POM33_YEAST | POM33 | genetic | 27708008 | |
COX12_YEAST | COX12 | genetic | 27708008 | |
VID22_YEAST | VID22 | genetic | 27708008 | |
GBLP_YEAST | ASC1 | genetic | 27708008 | |
PHO80_YEAST | PHO80 | genetic | 27708008 | |
RS10A_YEAST | RPS10A | genetic | 27708008 | |
MNE1_YEAST | MNE1 | genetic | 27708008 | |
VPS4_YEAST | VPS4 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...