| UniProt ID | PACA_HUMAN | |
|---|---|---|
| UniProt AC | P18509 | |
| Protein Name | Pituitary adenylate cyclase-activating polypeptide | |
| Gene Name | ADCYAP1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 176 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Binding to its receptor activates G proteins and stimulates adenylate cyclase in pituitary cells. Promotes neuron projection development through the RAPGEF2/Rap1/B-Raf/ERK pathway. In chromaffin cells, induces long-lasting increase of intracellular calcium concentrations and neuroendocrine secretion (By similarity). Involved in the control of glucose homeostasis, induces insulin secretion by pancreatic beta cells (By similarity).. | |
| Protein Sequence | MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MTMCSGARL ------CCCCHHHHH | 27.21 | 24043423 | |
| 5 | Phosphorylation | ---MTMCSGARLALL ---CCCCHHHHHHHH | 25.35 | 24043423 | |
| 14 | Phosphorylation | ARLALLVYGIIMHSS HHHHHHHHHHHHCHH | 11.54 | 24043423 | |
| 20 | Phosphorylation | VYGIIMHSSVYSSPA HHHHHHCHHCCCCCC | 12.24 | 24043423 | |
| 21 | Phosphorylation | YGIIMHSSVYSSPAA HHHHHCHHCCCCCCC | 15.47 | 24043423 | |
| 23 | Phosphorylation | IIMHSSVYSSPAAAG HHHCHHCCCCCCCCC | 12.84 | 24043423 | |
| 24 | Phosphorylation | IMHSSVYSSPAAAGL HHCHHCCCCCCCCCC | 27.91 | 24043423 | |
| 25 | Phosphorylation | MHSSVYSSPAAAGLR HCHHCCCCCCCCCCC | 10.81 | 24043423 | |
| 141 | Phosphorylation | DGIFTDSYSRYRKQM CCCCCCHHHHHHHHH | 10.44 | 50563729 | |
| 142 | Phosphorylation | GIFTDSYSRYRKQMA CCCCCHHHHHHHHHH | 27.13 | 50563735 | |
| 153 | Phosphorylation | KQMAVKKYLAAVLGK HHHHHHHHHHHHHHH | 8.89 | 119505 | |
| 158 | Leucine amide | KKYLAAVLGKRYKQR HHHHHHHHHHHHHHH | 6.00 | - | |
| 158 | Amidation | KKYLAAVLGKRYKQR HHHHHHHHHHHHHHH | 6.00 | 2302217 | |
| 162 | Phosphorylation | AAVLGKRYKQRVKNK HHHHHHHHHHHHHHC | 18.24 | 119509 | |
| 169 | Lysine amide | YKQRVKNKGRRIAYL HHHHHHHCCCCEECC | 48.34 | - | |
| 169 | Amidation | YKQRVKNKGRRIAYL HHHHHHHCCCCEECC | 48.34 | 2302217 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PACA_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PACA_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PACA_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
