T10B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: T10B_HUMAN
• UniProt AC: Q9Y5J6
• Protein Name: Mitochondrial import inner membrane translocase subunit Tim10 B
• Gene Name: TIMM10B
• Organism: Homo sapiens (Human).
• Sequence Length: 103
• Subcellular Localization: Mitochondrion inner membrane ; Peripheral membrane protein .
• Protein Description: Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space..
• Protein Sequence: MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
55	Ubiquitination	CLHSCAGKLIHSNHR HHHHHHHHHHHCHHH		-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of T10B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of T10B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of T10B_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of T10B_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.