UniProt ID | CETN3_HUMAN | |
---|---|---|
UniProt AC | O15182 | |
Protein Name | Centrin-3 | |
Gene Name | CETN3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 167 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Nucleus, nucleolus . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole . Centrosome of interphase and mitotic cells (PubMed:9256449). Localizes to centri | |
Protein Description | Plays a fundamental role in microtubule-organizing center structure and function.; Component of the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, SEM1, and either centrin CETN2 or CETN3. [PubMed: 22307388 The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery] | |
Protein Sequence | MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Acetylation | RSELVVDKTKRKKRR HHHHHHCHHHHHHHH | 44.32 | 25953088 | |
18 | Ubiquitination | VDKTKRKKRRELSEE HCHHHHHHHHHCCHH | 61.80 | - | |
23 | Phosphorylation | RKKRRELSEEQKQEI HHHHHHCCHHHHHHH | 34.04 | - | |
39 | Phosphorylation | DAFELFDTDKDEAID HHHHHHCCCHHHCCC | 37.30 | - | |
47 | Phosphorylation | DKDEAIDYHELKVAM CHHHCCCHHHHHHHH | 7.35 | - | |
51 | Ubiquitination | AIDYHELKVAMRALG CCCHHHHHHHHHHCC | 25.59 | - | |
62 | Ubiquitination | RALGFDVKKADVLKI HHCCCCCCHHHHHHH | 44.05 | - | |
68 | Ubiquitination | VKKADVLKILKDYDR CCHHHHHHHHHCCCC | 45.93 | - | |
71 | Ubiquitination | ADVLKILKDYDREAT HHHHHHHHCCCCCCC | 58.68 | - | |
105 | Ubiquitination | DPHEEILKAFKLFDD CCHHHHHHHHCCCCC | 58.39 | - | |
108 | Ubiquitination | EEILKAFKLFDDDDS HHHHHHHCCCCCCCC | 53.77 | 21890473 | |
117 | Ubiquitination | FDDDDSGKISLRNLR CCCCCCCCCCHHHHH | 32.83 | 21890473 | |
125 | Dimethylation | ISLRNLRRVARELGE CCHHHHHHHHHHHHC | 29.61 | - | |
134 | Sulfoxidation | ARELGENMSDEELRA HHHHHCCCCHHHHHH | 4.68 | 21406390 | |
135 | Phosphorylation | RELGENMSDEELRAM HHHHCCCCHHHHHHH | 54.15 | 28985074 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CETN3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CETN3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CETN3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PDE6D_HUMAN | PDE6D | physical | 16169070 | |
LRIF1_HUMAN | LRIF1 | physical | 16169070 | |
U119A_HUMAN | UNC119 | physical | 16169070 | |
SGSM1_HUMAN | SGSM1 | physical | 25416956 | |
POC5_HUMAN | POC5 | physical | 25416956 | |
TELT_HUMAN | TCAP | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...