UniProt ID | JAC1_YEAST | |
---|---|---|
UniProt AC | P53193 | |
Protein Name | J-type co-chaperone JAC1, mitochondrial | |
Gene Name | JAC1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 184 | |
Subcellular Localization | Mitochondrion matrix . | |
Protein Description | Co-chaperone required for the assembly of iron-sulfur (Fe/S) clusters in mitochondria. Stimulates the ATPase activity of its specialized Hsp70 chaperone partner SSQ1. Binds to the substrate protein ISU1 and targets it to SSQ1. May function together with SSQ1 in the dislocation of the Fe/S cluster from ISU1 and its insertion into apoproteins.. | |
Protein Sequence | MLKYLVQRRFTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGKQLEMNH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of JAC1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of JAC1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of JAC1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HSP7Q_YEAST | SSQ1 | genetic | 11278728 | |
ISU1_YEAST | ISU1 | physical | 16551614 | |
RS8A_YEAST | RPS8A | genetic | 20093466 | |
RS8B_YEAST | RPS8A | genetic | 20093466 | |
PP2C4_YEAST | PTC4 | genetic | 20093466 | |
BRE4_YEAST | BRE4 | genetic | 20093466 | |
WDR59_YEAST | MTC5 | genetic | 20093466 | |
LIC4_YEAST | ATC1 | genetic | 20093466 | |
PEX5_YEAST | PEX5 | genetic | 20093466 | |
RLA4_YEAST | RPP2B | genetic | 20093466 | |
EMI1_YEAST | EMI1 | genetic | 20093466 | |
MMS2_YEAST | MMS2 | genetic | 20093466 | |
MPC1_YEAST | MPC1 | genetic | 20093466 | |
PTH_YEAST | PTH1 | genetic | 20093466 | |
YRA2_YEAST | YRA2 | genetic | 20093466 | |
PPR1_YEAST | PPR1 | genetic | 20093466 | |
YPT6_YEAST | YPT6 | genetic | 20093466 | |
AEP2_YEAST | AEP2 | genetic | 20093466 | |
MAS5_YEAST | YDJ1 | genetic | 20093466 | |
MED9_YEAST | CSE2 | genetic | 20093466 | |
INO4_YEAST | INO4 | genetic | 20093466 | |
CY1_YEAST | CYT1 | genetic | 20093466 | |
VAM3_YEAST | VAM3 | genetic | 20093466 | |
HSP7F_YEAST | SSE1 | genetic | 20093466 | |
QCR2_YEAST | QCR2 | genetic | 20093466 | |
NFS1_YEAST | NFS1 | genetic | 18843040 | |
ISU1_YEAST | ISU1 | physical | 24573684 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...