UniProt ID | FPPS_YEAST | |
---|---|---|
UniProt AC | P08524 | |
Protein Name | Farnesyl pyrophosphate synthase | |
Gene Name | ERG20 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 352 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Catalyzes the sequential condensation of isopentenyl pyrophosphate with the allylic pyrophosphates, dimethylallyl pyrophosphate, and then with the resultant geranylpyrophosphate to the ultimate product farnesyl pyrophosphate.. | |
Protein Sequence | MASEKEIRRERFLNVFPKLVEELNASLLAYGMPKEACDWYAHSLNYNTPGGKLNRGLSVVDTYAILSNKTVEQLGQEEYEKVAILGWCIELLQAYFLVADDMMDKSITRRGQPCWYKVPEVGEIAINDAFMLEAAIYKLLKSHFRNEKYYIDITELFHEVTFQTELGQLMDLITAPEDKVDLSKFSLKKHSFIVTFKTAYYSFYLPVALAMYVAGITDEKDLKQARDVLIPLGEYFQIQDDYLDCFGTPEQIGKIGTDIQDNKCSWVINKALELASAEQRKTLDENYGKKDSVAEAKCKKIFNDLKIEQLYHEYEESIAKDLKAKISQVDESRGFKADVLTAFLNKVYKRSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
46 | Phosphorylation | WYAHSLNYNTPGGKL HHHHHCCCCCCCCCC | 26.21 | 23749301 | |
52 | Acetylation | NYNTPGGKLNRGLSV CCCCCCCCCCCCCEE | 48.80 | 24489116 | |
52 | Ubiquitination | NYNTPGGKLNRGLSV CCCCCCCCCCCCCEE | 48.80 | 23749301 | |
58 | Phosphorylation | GKLNRGLSVVDTYAI CCCCCCCEEHHHHHH | 23.95 | 30377154 | |
184 | Acetylation | EDKVDLSKFSLKKHS CCCCCHHHHCCCCCE | 46.39 | 22865919 | |
263 | Ubiquitination | GTDIQDNKCSWVINK CCCCCCCCHHHHHHH | 37.62 | 23749301 | |
263 | Acetylation | GTDIQDNKCSWVINK CCCCCCCCHHHHHHH | 37.62 | 24489116 | |
276 | Phosphorylation | NKALELASAEQRKTL HHHHHHCCHHHHHCH | 44.99 | 22369663 | |
289 | Acetylation | TLDENYGKKDSVAEA CHHHHCCCCCHHHHH | 42.94 | 22865919 | |
289 | Succinylation | TLDENYGKKDSVAEA CHHHHCCCCCHHHHH | 42.94 | 23954790 | |
292 | Phosphorylation | ENYGKKDSVAEAKCK HHCCCCCHHHHHHHH | 31.91 | 27214570 | |
297 | Ubiquitination | KDSVAEAKCKKIFND CCHHHHHHHHHHHHH | 37.78 | 23749301 | |
300 | Acetylation | VAEAKCKKIFNDLKI HHHHHHHHHHHHHHH | 63.10 | 22865919 | |
306 | Acetylation | KKIFNDLKIEQLYHE HHHHHHHHHHHHHHH | 47.24 | 24489116 | |
317 | Phosphorylation | LYHEYEESIAKDLKA HHHHHHHHHHHHHHH | 18.86 | 24961812 | |
320 | Acetylation | EYEESIAKDLKAKIS HHHHHHHHHHHHHHH | 63.02 | 24489116 | |
325 | Ubiquitination | IAKDLKAKISQVDES HHHHHHHHHHHCCCC | 41.10 | 23749301 | |
336 | Ubiquitination | VDESRGFKADVLTAF CCCCCCCCHHHHHHH | 46.64 | 23749301 | |
336 | Acetylation | VDESRGFKADVLTAF CCCCCCCCHHHHHHH | 46.64 | 24489116 | |
346 | Ubiquitination | VLTAFLNKVYKRSK- HHHHHHHHHHHHCC- | 49.44 | 17644757 | |
346 | Acetylation | VLTAFLNKVYKRSK- HHHHHHHHHHHHCC- | 49.44 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FPPS_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FPPS_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FPPS_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TBP7_YEAST | YTA7 | physical | 19416104 | |
HIR3_YEAST | HIR3 | physical | 19416104 | |
MED17_YEAST | SRB4 | physical | 19416104 | |
COQ8_YEAST | COQ8 | physical | 19416104 | |
HAP1_YEAST | HAP1 | physical | 19416104 | |
IDH1_YEAST | IDH1 | genetic | 21623372 | |
ATPO_YEAST | ATP5 | genetic | 21623372 | |
PPT2_YEAST | PPT2 | genetic | 21623372 | |
COX6_YEAST | COX6 | genetic | 21623372 | |
GGPPS_YEAST | BTS1 | genetic | 21623372 | |
THRC_YEAST | THR4 | genetic | 21623372 | |
ADK_YEAST | ADO1 | genetic | 21623372 | |
LCB5_YEAST | LCB5 | genetic | 21623372 | |
IDH2_YEAST | IDH2 | genetic | 21623372 | |
SUR1_YEAST | SUR1 | genetic | 21623372 | |
PDE2_YEAST | PDE2 | genetic | 21623372 | |
PHO87_YEAST | PHO87 | genetic | 21623372 | |
SCS7_YEAST | SCS7 | genetic | 21623372 | |
PSB1_YEAST | PRE3 | genetic | 23891562 | |
PSB5_YEAST | PRE2 | genetic | 23891562 | |
PSA4_YEAST | PRE6 | genetic | 23891562 | |
PSA7_YEAST | PRE10 | genetic | 23891562 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...