UniProt ID | DAF_HUMAN | |
---|---|---|
UniProt AC | P08174 | |
Protein Name | Complement decay-accelerating factor | |
Gene Name | CD55 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 381 | |
Subcellular Localization |
Isoform 1: Cell membrane Single-pass type I membrane protein. Isoform 2: Cell membrane Lipid-anchor, GPI-anchor. Isoform 3: Secreted . Isoform 4: Secreted . Isoform 5: Secreted . Isoform 6: Cell membrane Lipid-anchor, GPI-anchor . Isoform 7: Cel |
|
Protein Description | This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. [PubMed: 7525274 Inhibits complement activation by destabilizing and preventing the formation of C3 and C5 convertases, which prevents complement damage] | |
Protein Sequence | MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHTCFTLTGLLGTLVTMGLLT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
64 | Ubiquitination | EDTVITYKCEESFVK CCCEEEEECCCCEEE | 26.90 | - | |
71 | Ubiquitination | KCEESFVKIPGEKDS ECCCCEEECCCCCCE | 40.97 | - | |
76 | Ubiquitination | FVKIPGEKDSVICLK EEECCCCCCEEEEEE | 62.31 | - | |
95 | N-linked_Glycosylation | SDIEEFCNRSCEVPT HHHHHHHCCCCCCCC | 44.19 | 17660510 | |
110 | Ubiquitination | RLNSASLKQPYITQN CCCCCCCCCCEECCC | 46.89 | - | |
138 | Phosphorylation | PGYRREPSLSPKLTC CCCCCCCCCCCCEEH | 36.40 | 24719451 | |
140 | Phosphorylation | YRREPSLSPKLTCLQ CCCCCCCCCCEEHHH | 25.07 | 20068231 | |
142 | Acetylation | REPSLSPKLTCLQNL CCCCCCCCEEHHHHC | 53.72 | 26051181 | |
142 | Ubiquitination | REPSLSPKLTCLQNL CCCCCCCCEEHHHHC | 53.72 | - | |
159 | Acetylation | STAVEFCKKKSCPNP HHHHHHHHHCCCCCC | 69.43 | 26051181 | |
161 | Succinylation | AVEFCKKKSCPNPGE HHHHHHHCCCCCCCC | 42.67 | 27452117 | |
162 | Phosphorylation | VEFCKKKSCPNPGEI HHHHHHCCCCCCCCC | 43.62 | - | |
245 | Phosphorylation | GERDHYGYRQSVTYA CCCCCCCCCHHHEEE | 9.79 | - | |
251 | Phosphorylation | GYRQSVTYACNKGFT CCCHHHEEEECCCEE | 13.65 | - | |
266 | Phosphorylation | MIGEHSIYCTVNNDE EEEECEEEEEEECCC | 5.77 | - | |
290 | Phosphorylation | CRGKSLTSKVPPTVQ CCCCCCCCCCCCCCC | 36.63 | 29116813 | |
291 | Ubiquitination | RGKSLTSKVPPTVQK CCCCCCCCCCCCCCC | 54.23 | - | |
295 | Phosphorylation | LTSKVPPTVQKPTTV CCCCCCCCCCCCCEE | 29.51 | 29116813 | |
298 | Ubiquitination | KVPPTVQKPTTVNVP CCCCCCCCCCEEECC | 39.74 | - | |
300 | Phosphorylation | PPTVQKPTTVNVPTT CCCCCCCCEEECCCC | 50.87 | 22210691 | |
301 | Phosphorylation | PTVQKPTTVNVPTTE CCCCCCCEEECCCCE | 20.71 | 29116813 | |
306 | O-linked_Glycosylation | PTTVNVPTTEVSPTS CCEEECCCCEECCCC | 31.16 | OGP | |
306 | Phosphorylation | PTTVNVPTTEVSPTS CCEEECCCCEECCCC | 31.16 | 25627689 | |
307 | O-linked_Glycosylation | TTVNVPTTEVSPTSQ CEEECCCCEECCCCC | 28.46 | OGP | |
310 | Phosphorylation | NVPTTEVSPTSQKTT ECCCCEECCCCCCEE | 19.07 | 25159151 | |
312 | O-linked_Glycosylation | PTTEVSPTSQKTTTK CCCEECCCCCCEECC | 35.96 | OGP | |
312 | Phosphorylation | PTTEVSPTSQKTTTK CCCEECCCCCCEECC | 35.96 | 22210691 | |
313 | Phosphorylation | TTEVSPTSQKTTTKT CCEECCCCCCEECCC | 32.82 | 22210691 | |
315 | Ubiquitination | EVSPTSQKTTTKTTT EECCCCCCEECCCCC | 47.83 | - | |
319 | Ubiquitination | TSQKTTTKTTTPNAQ CCCCEECCCCCCCCC | 41.61 | - | |
334 | Phosphorylation | ATRSTPVSRTTKHFH CCCCCCCCCCCCEEE | 25.72 | - | |
338 | Ubiquitination | TPVSRTTKHFHETTP CCCCCCCCEEEECCC | 43.59 | - | |
343 | O-linked_Glycosylation | TTKHFHETTPNKGSG CCCEEEECCCCCCCC | 38.70 | 55827263 | |
344 | O-linked_Glycosylation | TKHFHETTPNKGSGT CCEEEECCCCCCCCC | 23.14 | 55827267 | |
347 | Ubiquitination | FHETTPNKGSGTTSG EEECCCCCCCCCCCC | 56.51 | - | |
351 | O-linked_Glycosylation | TPNKGSGTTSGTTRL CCCCCCCCCCCCEEE | 21.34 | OGP | |
352 | O-linked_Glycosylation | PNKGSGTTSGTTRLL CCCCCCCCCCCEEEC | 28.78 | OGP | |
353 | GPI-anchor | NKGSGTTSGTTRLLS CCCCCCCCCCEEECC | 33.70 | 1824699 | |
353 | O-linked_Glycosylation | NKGSGTTSGTTRLLS CCCCCCCCCCEEECC | 33.70 | OGP | |
360 | Phosphorylation | SGTTRLLSGHTCFTL CCCEEECCCCHHHHH | 32.87 | 24719451 | |
360 (in isoform 2) | Phosphorylation | - | 32.87 | 19664995 | |
362 (in isoform 2) | Phosphorylation | - | 18.98 | 27282143 | |
363 | Phosphorylation | TRLLSGHTCFTLTGL EEECCCCHHHHHHHH | 16.91 | 24719451 | |
366 (in isoform 2) | Phosphorylation | - | 26.09 | 19664995 | |
372 (in isoform 6) | Phosphorylation | - | 23.26 | 28634298 | |
372 (in isoform 7) | Phosphorylation | - | 23.26 | 28634298 | |
373 (in isoform 6) | Phosphorylation | - | 20.30 | 28634298 | |
373 (in isoform 7) | Phosphorylation | - | 20.30 | 28634298 | |
376 | Phosphorylation | GLLGTLVTMGLLT-- HHHHHHHHHCCCC-- | 14.50 | 24719451 | |
379 (in isoform 7) | Phosphorylation | - | 3.11 | 28634298 | |
379 (in isoform 6) | Phosphorylation | - | 3.11 | 28634298 | |
382 (in isoform 6) | Phosphorylation | - | 28634298 | ||
382 (in isoform 7) | Phosphorylation | - | 28634298 | ||
383 (in isoform 6) | Phosphorylation | - | 28634298 | ||
383 (in isoform 7) | Phosphorylation | - | 28634298 | ||
415 (in isoform 7) | Phosphorylation | - | 25627689 | ||
415 (in isoform 6) | Phosphorylation | - | 25627689 | ||
427 (in isoform 6) | Phosphorylation | - | 30206219 | ||
427 (in isoform 7) | Phosphorylation | - | 30206219 | ||
429 (in isoform 7) | Phosphorylation | - | 30206219 | ||
429 (in isoform 6) | Phosphorylation | - | 30206219 | ||
429 (in isoform 5) | Phosphorylation | - | - | ||
430 (in isoform 7) | Phosphorylation | - | 30206219 | ||
430 (in isoform 6) | Phosphorylation | - | 30206219 | ||
430 (in isoform 2) | Phosphorylation | - | - | ||
432 (in isoform 7) | Phosphorylation | - | 30206219 | ||
432 (in isoform 6) | Phosphorylation | - | 30206219 | ||
434 (in isoform 7) | Phosphorylation | - | 30206219 | ||
434 (in isoform 6) | Phosphorylation | - | 30206219 | ||
442 (in isoform 7) | Phosphorylation | - | 30206219 | ||
442 (in isoform 6) | Phosphorylation | - | 30206219 | ||
445 (in isoform 6) | Phosphorylation | - | 30206219 | ||
445 (in isoform 7) | Phosphorylation | - | 30206219 | ||
447 (in isoform 7) | Phosphorylation | - | 30206219 | ||
447 (in isoform 6) | Phosphorylation | - | 30206219 | ||
450 (in isoform 7) | Phosphorylation | - | 30206219 | ||
450 (in isoform 6) | Phosphorylation | - | 30206219 | ||
452 (in isoform 7) | Phosphorylation | - | 30206219 | ||
452 (in isoform 6) | Phosphorylation | - | 30206219 | ||
478 (in isoform 7) | Phosphorylation | - | 25627689 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DAF_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DAF_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DAF_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DAF_HUMAN | CD55 | physical | 12499389 | |
NDUB7_HUMAN | NDUFB7 | physical | 22939629 | |
MPV17_HUMAN | MPV17 | physical | 22939629 | |
MA2A1_HUMAN | MAN2A1 | physical | 22939629 | |
RAB31_HUMAN | RAB31 | physical | 22939629 | |
PTCD3_HUMAN | PTCD3 | physical | 22939629 | |
GTR1_HUMAN | SLC2A1 | physical | 22939629 | |
RM04_HUMAN | MRPL4 | physical | 22939629 | |
GNAI3_HUMAN | GNAI3 | physical | 22939629 | |
INF2_HUMAN | INF2 | physical | 22939629 | |
FACE1_HUMAN | ZMPSTE24 | physical | 22939629 | |
PTH2_HUMAN | PTRH2 | physical | 22939629 | |
S10AA_HUMAN | S100A10 | physical | 22939629 | |
SYJ2B_HUMAN | SYNJ2BP | physical | 22939629 | |
TIM50_HUMAN | TIMM50 | physical | 22939629 | |
S12A4_HUMAN | SLC12A4 | physical | 22939629 | |
NDUS7_HUMAN | NDUFS7 | physical | 22939629 | |
VATE1_HUMAN | ATP6V1E1 | physical | 22939629 | |
SCMC1_HUMAN | SLC25A24 | physical | 22939629 | |
PICAL_HUMAN | PICALM | physical | 22939629 | |
CH3L1_HUMAN | CHI3L1 | physical | 26186194 | |
CF120_HUMAN | C6orf120 | physical | 26186194 | |
CH3L1_HUMAN | CHI3L1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
H00106 | Complement regulatory protein defects, including the following six diseases: C1 inhibitor deficiency | |||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
GPI-anchor | |
Reference | PubMed |
"Modification-specific proteomics of plasma membrane proteins:identification and characterization of glycosylphosphatidylinositol-anchored proteins released upon phospholipase D treatment."; Elortza F., Mohammed S., Bunkenborg J., Foster L.J., Nuehse T.S.,Brodbeck U., Peck S.C., Jensen O.N.; J. Proteome Res. 5:935-943(2006). Cited for: GPI-ANCHOR [LARGE SCALE ANALYSIS], AND MASS SPECTROMETRY. | |
"Proteomic analysis of glycosylphosphatidylinositol-anchored membraneproteins."; Elortza F., Nuehse T.S., Foster L.J., Stensballe A., Peck S.C.,Jensen O.N.; Mol. Cell. Proteomics 2:1261-1270(2003). Cited for: GPI-ANCHOR [LARGE SCALE ANALYSIS], AND MASS SPECTROMETRY. | |
"Glycophospholipid membrane anchor attachment. Molecular analysis ofthe cleavage/attachment site."; Moran P., Raab H., Kohr W.J., Caras I.W.; J. Biol. Chem. 266:1250-1257(1991). Cited for: GPI-ANCHOR AT SER-353. | |
N-linked Glycosylation | |
Reference | PubMed |
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry."; Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.; J. Proteome Res. 8:651-661(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-95, AND MASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"Improved titanium dioxide enrichment of phosphopeptides from HeLacells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra."; Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D.; J. Proteome Res. 6:4150-4162(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-140, AND MASSSPECTROMETRY. |