UniProt ID | SYJ2B_HUMAN | |
---|---|---|
UniProt AC | P57105 | |
Protein Name | Synaptojanin-2-binding protein | |
Gene Name | SYNJ2BP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 145 | |
Subcellular Localization | Mitochondrion outer membrane. | |
Protein Description | Regulates endocytosis of activin type 2 receptor kinases through the Ral/RALBP1-dependent pathway and may be involved in suppression of activin-induced signal transduction.. | |
Protein Sequence | MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMVAAWAFMRYRQQL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MNGRVDYLVTEEEI -CCCCCEEEEEHHHH | 10.54 | 27642862 | |
21 | Phosphorylation | INLTRGPSGLGFNIV HCCCCCCCCCCCEEE | 49.85 | 25849741 | |
31 | Phosphorylation | GFNIVGGTDQQYVSN CCEEECCCCCCEECC | 25.38 | 30622161 | |
37 | Phosphorylation | GTDQQYVSNDSGIYV CCCCCEECCCCCEEE | 29.95 | 30622161 | |
40 | Phosphorylation | QQYVSNDSGIYVSRI CCEECCCCCEEEEEE | 31.20 | 25159151 | |
45 | Phosphorylation | NDSGIYVSRIKENGA CCCCEEEEEECCCCC | 16.00 | 30622161 | |
48 | Ubiquitination | GIYVSRIKENGAAAL CEEEEEECCCCCEEE | 43.97 | - | |
48 | Malonylation | GIYVSRIKENGAAAL CEEEEEECCCCCEEE | 43.97 | 26320211 | |
64 | Ubiquitination | GRLQEGDKILSVNGQ CCCCCCCEEEEECHH | 57.30 | 21890473 | |
67 | Phosphorylation | QEGDKILSVNGQDLK CCCCEEEEECHHHHH | 19.60 | 25404012 | |
74 | Ubiquitination | SVNGQDLKNLLHQDA EECHHHHHHHHCHHH | 54.56 | - | |
90 | Phosphorylation | DLFRNAGYAVSLRVQ HHHHHCCCEEEEEEE | 11.04 | 21406692 | |
93 | Phosphorylation | RNAGYAVSLRVQHRL HHCCCEEEEEEEEEE | 11.42 | 21406692 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYJ2B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYJ2B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYJ2B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LRP1_HUMAN | LRP1 | physical | 10827173 | |
LRP2_HUMAN | LRP2 | physical | 10827173 | |
SYNJ2_HUMAN | SYNJ2 | physical | 10357812 | |
AVR2B_HUMAN | ACVR2B | physical | 11882656 | |
AVR2A_HUMAN | ACVR2A | physical | 11882656 | |
RBP1_HUMAN | RALBP1 | physical | 11882656 | |
A4_HUMAN | APP | physical | 21832049 | |
USBP1_HUMAN | USHBP1 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...