| UniProt ID | SYJ2B_HUMAN | |
|---|---|---|
| UniProt AC | P57105 | |
| Protein Name | Synaptojanin-2-binding protein | |
| Gene Name | SYNJ2BP | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 145 | |
| Subcellular Localization | Mitochondrion outer membrane. | |
| Protein Description | Regulates endocytosis of activin type 2 receptor kinases through the Ral/RALBP1-dependent pathway and may be involved in suppression of activin-induced signal transduction.. | |
| Protein Sequence | MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMVAAWAFMRYRQQL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MNGRVDYLVTEEEI -CCCCCEEEEEHHHH | 10.54 | 27642862 | |
| 21 | Phosphorylation | INLTRGPSGLGFNIV HCCCCCCCCCCCEEE | 49.85 | 25849741 | |
| 31 | Phosphorylation | GFNIVGGTDQQYVSN CCEEECCCCCCEECC | 25.38 | 30622161 | |
| 37 | Phosphorylation | GTDQQYVSNDSGIYV CCCCCEECCCCCEEE | 29.95 | 30622161 | |
| 40 | Phosphorylation | QQYVSNDSGIYVSRI CCEECCCCCEEEEEE | 31.20 | 25159151 | |
| 45 | Phosphorylation | NDSGIYVSRIKENGA CCCCEEEEEECCCCC | 16.00 | 30622161 | |
| 48 | Ubiquitination | GIYVSRIKENGAAAL CEEEEEECCCCCEEE | 43.97 | - | |
| 48 | Malonylation | GIYVSRIKENGAAAL CEEEEEECCCCCEEE | 43.97 | 26320211 | |
| 64 | Ubiquitination | GRLQEGDKILSVNGQ CCCCCCCEEEEECHH | 57.30 | 21890473 | |
| 67 | Phosphorylation | QEGDKILSVNGQDLK CCCCEEEEECHHHHH | 19.60 | 25404012 | |
| 74 | Ubiquitination | SVNGQDLKNLLHQDA EECHHHHHHHHCHHH | 54.56 | - | |
| 90 | Phosphorylation | DLFRNAGYAVSLRVQ HHHHHCCCEEEEEEE | 11.04 | 21406692 | |
| 93 | Phosphorylation | RNAGYAVSLRVQHRL HHCCCEEEEEEEEEE | 11.42 | 21406692 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYJ2B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYJ2B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYJ2B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| LRP1_HUMAN | LRP1 | physical | 10827173 | |
| LRP2_HUMAN | LRP2 | physical | 10827173 | |
| SYNJ2_HUMAN | SYNJ2 | physical | 10357812 | |
| AVR2B_HUMAN | ACVR2B | physical | 11882656 | |
| AVR2A_HUMAN | ACVR2A | physical | 11882656 | |
| RBP1_HUMAN | RALBP1 | physical | 11882656 | |
| A4_HUMAN | APP | physical | 21832049 | |
| USBP1_HUMAN | USHBP1 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
