| UniProt ID | C1D_HUMAN | |
|---|---|---|
| UniProt AC | Q13901 | |
| Protein Name | Nuclear nucleic acid-binding protein C1D | |
| Gene Name | C1D | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 141 | |
| Subcellular Localization | Nucleus . Cytoplasm . Nucleus, nucleolus . EXOSC10 is required for nucleolar localization (PubMed:17412707). Colocalizes with TSNAX in the nucleus (PubMed:11801738). | |
| Protein Description | Plays a role in the recruitment of the RNA exosome complex to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA; this function may include MPHOSPH6. Can activate PRKDC not only in the presence of linear DNA but also in the presence of supercoiled DNA. Can induce apoptosis in a p53/TP53 dependent manner. May regulate the TRAX/TSN complex formation. Potentiates transcriptional repression by NR1D1 and THRB (By similarity).. | |
| Protein Sequence | MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 39 | Phosphorylation | LKTMMSVSRNELLQK HHHHHHCCHHHHHHH | 23.29 | 24719451 | |
| 46 | Ubiquitination | SRNELLQKLDPLEQA CHHHHHHHCCHHHHH | 55.62 | 21906983 | |
| 59 | Phosphorylation | QAKVDLVSAYTLNSM HHCHHHHHHHHHHHH | 23.90 | 30206219 | |
| 61 | Phosphorylation | KVDLVSAYTLNSMFW CHHHHHHHHHHHHHH | 12.31 | 30206219 | |
| 62 | Phosphorylation | VDLVSAYTLNSMFWV HHHHHHHHHHHHHHH | 21.12 | 30206219 | |
| 65 | Phosphorylation | VSAYTLNSMFWVYLA HHHHHHHHHHHHHHH | 20.61 | 30206219 | |
| 70 | Phosphorylation | LNSMFWVYLATQGVN HHHHHHHHHHHCCCC | 4.92 | 30206219 | |
| 73 | Phosphorylation | MFWVYLATQGVNPKE HHHHHHHHCCCCCCC | 24.22 | 30206219 | |
| 84 | Acetylation | NPKEHPVKQELERIR CCCCCCHHHHHHHHH | 42.37 | 26051181 | |
| 93 | Phosphorylation | ELERIRVYMNRVKEI HHHHHHHHHHHHHHH | 4.46 | 29496907 | |
| 103 | Ubiquitination | RVKEITDKKKAGKLD HHHHHCCHHHCCCCC | 47.74 | 24816145 | |
| 115 | Phosphorylation | KLDRGAASRFVKNAL CCCHHHHHHHHHHHH | 26.22 | - | |
| 119 | Sumoylation | GAASRFVKNALWEPK HHHHHHHHHHHCCCC | 33.52 | - | |
| 119 | Ubiquitination | GAASRFVKNALWEPK HHHHHHHHHHHCCCC | 33.52 | 29967540 | |
| 119 | Sumoylation | GAASRFVKNALWEPK HHHHHHHHHHHCCCC | 33.52 | 28112733 | |
| 126 | Sumoylation | KNALWEPKSKNASKV HHHHCCCCCCCHHHH | 63.65 | 28112733 | |
| 132 | Sumoylation | PKSKNASKVANKGKS CCCCCHHHHHHCCCC | 42.85 | 28112733 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of C1D_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of C1D_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of C1D_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
