UniProt ID | YP119_YEAST | |
---|---|---|
UniProt AC | Q3E751 | |
Protein Name | Uncharacterized protein YPL119C-A | |
Gene Name | YPL119C-A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 87 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MHPLVDELTLSRYLTHGTSVLSSSLYSVAFFLFFFPNFLFFCSCPNHKWVSLPFIGMDILEALCFYREGKIRNIFEIGGLLLQSFYN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YP119_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YP119_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YP119_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YP119_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DPOA2_YEAST | POL12 | genetic | 27708008 | |
SYIC_YEAST | ILS1 | genetic | 27708008 | |
ORC2_YEAST | ORC2 | genetic | 27708008 | |
MED8_YEAST | MED8 | genetic | 27708008 | |
ENP1_YEAST | ENP1 | genetic | 27708008 | |
TECR_YEAST | TSC13 | genetic | 27708008 | |
CDC53_YEAST | CDC53 | genetic | 27708008 | |
UBC3_YEAST | CDC34 | genetic | 27708008 | |
TAF12_YEAST | TAF12 | genetic | 27708008 | |
TRS23_YEAST | TRS23 | genetic | 27708008 | |
TFC6_YEAST | TFC6 | genetic | 27708008 | |
RSP5_YEAST | RSP5 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
CDC20_YEAST | CDC20 | genetic | 27708008 | |
MED6_YEAST | MED6 | genetic | 27708008 | |
MET30_YEAST | MET30 | genetic | 27708008 | |
TIM16_YEAST | PAM16 | genetic | 27708008 | |
KRE9_YEAST | KRE9 | genetic | 27708008 | |
APC2_YEAST | APC2 | genetic | 27708008 | |
MPPB_YEAST | MAS1 | genetic | 27708008 | |
SEC10_YEAST | SEC10 | genetic | 27708008 | |
PWP1_YEAST | PWP1 | genetic | 27708008 | |
SEC22_YEAST | SEC22 | genetic | 27708008 | |
TAD3_YEAST | TAD3 | genetic | 27708008 | |
RNA1_YEAST | RNA1 | genetic | 27708008 | |
LIP1_YEAST | LIP1 | genetic | 27708008 | |
NOP2_YEAST | NOP2 | genetic | 27708008 | |
SMP3_YEAST | SMP3 | genetic | 27708008 | |
RPB2_YEAST | RPB2 | genetic | 27708008 | |
DIB1_YEAST | DIB1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...