| UniProt ID | YO192_YEAST | |
|---|---|---|
| UniProt AC | Q3E736 | |
| Protein Name | Uncharacterized protein YOR192C-C | |
| Gene Name | YOR192C-C | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 78 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MMIIIFIELCRIADSLSWIPKSLRRTSSTFYIPNIIALLKMESQQLSQNSPTFQKHTPIGHINHDQYNSDSGSYYTLM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YO192_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YO192_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YO192_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YO192_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PP2C1_YEAST | PTC1 | genetic | 27708008 | |
| SAC1_YEAST | SAC1 | genetic | 27708008 | |
| TAD3_YEAST | TAD3 | genetic | 27708008 | |
| RNA1_YEAST | RNA1 | genetic | 27708008 | |
| DCP2_YEAST | DCP2 | genetic | 27708008 | |
| TIM23_YEAST | TIM23 | genetic | 27708008 | |
| SEC12_YEAST | SEC12 | genetic | 27708008 | |
| SYA_YEAST | ALA1 | genetic | 27708008 | |
| TF2B_YEAST | SUA7 | genetic | 27708008 | |
| MET8_YEAST | MET8 | genetic | 27708008 | |
| KCC4_YEAST | KCC4 | genetic | 27708008 | |
| GPR1_YEAST | GPR1 | genetic | 27708008 | |
| YJB6_YEAST | YJL016W | genetic | 27708008 | |
| BUD8_YEAST | BUD8 | genetic | 27708008 | |
| U5071_YEAST | YML003W | genetic | 27708008 | |
| YO08A_YEAST | YOR008C-A | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...