UniProt ID | YO192_YEAST | |
---|---|---|
UniProt AC | Q3E736 | |
Protein Name | Uncharacterized protein YOR192C-C | |
Gene Name | YOR192C-C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 78 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MMIIIFIELCRIADSLSWIPKSLRRTSSTFYIPNIIALLKMESQQLSQNSPTFQKHTPIGHINHDQYNSDSGSYYTLM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YO192_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YO192_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YO192_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YO192_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PP2C1_YEAST | PTC1 | genetic | 27708008 | |
SAC1_YEAST | SAC1 | genetic | 27708008 | |
TAD3_YEAST | TAD3 | genetic | 27708008 | |
RNA1_YEAST | RNA1 | genetic | 27708008 | |
DCP2_YEAST | DCP2 | genetic | 27708008 | |
TIM23_YEAST | TIM23 | genetic | 27708008 | |
SEC12_YEAST | SEC12 | genetic | 27708008 | |
SYA_YEAST | ALA1 | genetic | 27708008 | |
TF2B_YEAST | SUA7 | genetic | 27708008 | |
MET8_YEAST | MET8 | genetic | 27708008 | |
KCC4_YEAST | KCC4 | genetic | 27708008 | |
GPR1_YEAST | GPR1 | genetic | 27708008 | |
YJB6_YEAST | YJL016W | genetic | 27708008 | |
BUD8_YEAST | BUD8 | genetic | 27708008 | |
U5071_YEAST | YML003W | genetic | 27708008 | |
YO08A_YEAST | YOR008C-A | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...