UniProt ID | YO097_YEAST | |
---|---|---|
UniProt AC | Q3E7Y9 | |
Protein Name | Uncharacterized protein YOL097W-A | |
Gene Name | YOL097W-A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 61 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MQSMICSSEHENLTCKYWPVSFLASWCENGSGTLMQKDGSLLYAVKNFSHIFEKKIFHTNL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YO097_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YO097_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YO097_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YO097_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDC24_YEAST | CDC24 | genetic | 27708008 | |
STU1_YEAST | STU1 | genetic | 27708008 | |
DPOA2_YEAST | POL12 | genetic | 27708008 | |
DBF4_YEAST | DBF4 | genetic | 27708008 | |
RRP1_YEAST | RRP1 | genetic | 27708008 | |
TRS23_YEAST | TRS23 | genetic | 27708008 | |
SRPR_YEAST | SRP101 | genetic | 27708008 | |
TFC6_YEAST | TFC6 | genetic | 27708008 | |
GNA1_YEAST | GNA1 | genetic | 27708008 | |
YIP1_YEAST | YIP1 | genetic | 27708008 | |
MED6_YEAST | MED6 | genetic | 27708008 | |
FDFT_YEAST | ERG9 | genetic | 27708008 | |
KTHY_YEAST | CDC8 | genetic | 27708008 | |
CDC42_YEAST | CDC42 | genetic | 27708008 | |
TAD3_YEAST | TAD3 | genetic | 27708008 | |
CBF3B_YEAST | CEP3 | genetic | 27708008 | |
GPI12_YEAST | GPI12 | genetic | 27708008 | |
LIP1_YEAST | LIP1 | genetic | 27708008 | |
NOP2_YEAST | NOP2 | genetic | 27708008 | |
RPB2_YEAST | RPB2 | genetic | 27708008 | |
SEC63_YEAST | SEC63 | genetic | 27708008 | |
NIP7_YEAST | NIP7 | genetic | 27708008 | |
DIB1_YEAST | DIB1 | genetic | 27708008 | |
BUR1_YEAST | SGV1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...