UniProt ID | YO038_YEAST | |
---|---|---|
UniProt AC | Q3E7Z9 | |
Protein Name | Uncharacterized protein YOL038C-A | |
Gene Name | YOL038C-A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 31 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKYMGSFLRKAATTNLFNSIKKRKVQNRAMS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MKYMGSFLRKAAT --CCCHHHHHHHHHH | 12.46 | 21126336 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YO038_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YO038_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YO038_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ERD2_YEAST | ERD2 | genetic | 27708008 | |
CALM_YEAST | CMD1 | genetic | 27708008 | |
MCM7_YEAST | MCM7 | genetic | 27708008 | |
CDC53_YEAST | CDC53 | genetic | 27708008 | |
FAL1_YEAST | FAL1 | genetic | 27708008 | |
CDC12_YEAST | CDC12 | genetic | 27708008 | |
MCM10_YEAST | MCM10 | genetic | 27708008 | |
PRP19_YEAST | PRP19 | genetic | 27708008 | |
ERO1_YEAST | ERO1 | genetic | 27708008 | |
HRR25_YEAST | HRR25 | genetic | 27708008 | |
YAJ9_YEAST | YAR029W | genetic | 27708008 | |
CSG2_YEAST | CSG2 | genetic | 27708008 | |
PYC2_YEAST | PYC2 | genetic | 27708008 | |
MGR1_YEAST | MGR1 | genetic | 27708008 | |
YD012_YEAST | YDL012C | genetic | 27708008 | |
PEX19_YEAST | PEX19 | genetic | 27708008 | |
SNF6_YEAST | SNF6 | genetic | 27708008 | |
MRT4_YEAST | MRT4 | genetic | 27708008 | |
UBI4P_YEAST | UBI4 | genetic | 27708008 | |
YL149_YEAST | YLR149C | genetic | 27708008 | |
EIF3J_YEAST | HCR1 | genetic | 27708008 | |
BUL2_YEAST | BUL2 | genetic | 27708008 | |
SCS7_YEAST | SCS7 | genetic | 27708008 | |
MED1_YEAST | MED1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...