UniProt ID | YND3_YEAST | |
---|---|---|
UniProt AC | P53964 | |
Protein Name | Uncharacterized membrane protein YNL033W | |
Gene Name | YNL033W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 284 | |
Subcellular Localization |
Cell membrane Single-pass membrane protein. |
|
Protein Description | ||
Protein Sequence | MLYSRESRTTVLFLALVTSLTVLCHSVDVTTVFTTSTITEITTVTAAPQPQNKAETALNTATNIIQTMQFLFNCAPFKWKGPLKITSCALNFIVLLLTAWGYLLKYLQENKLNSDADMEKMVGLGFGEMVGRIFGKGVGKAFTKMDITQKLVYPFEGSNRQKCLLMTVGENSIVPFHDLFTEICFDQYTLDSLSHHNHGSISILDAGSVSALGFADISSKMPSVSELYTLFGDYTIEVLGGITKLASTLNREDWQGERNGFAVLSRDRPNQTLLSVHMYSSSLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
270 | N-linked_Glycosylation | VLSRDRPNQTLLSVH EEECCCCCCEEEEEE | 48.65 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YND3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YND3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YND3_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SLX5_YEAST | SLX5 | genetic | 27708008 | |
PHB1_YEAST | PHB1 | genetic | 27708008 | |
EMC6_YEAST | EMC6 | genetic | 27708008 | |
INO4_YEAST | INO4 | genetic | 27708008 | |
CND2_YEAST | BRN1 | genetic | 27708008 | |
MED6_YEAST | MED6 | genetic | 27708008 | |
ARP4_YEAST | ARP4 | genetic | 27708008 | |
OST2_YEAST | OST2 | genetic | 27708008 | |
MED4_YEAST | MED4 | genetic | 27708008 | |
YAD7_YEAST | YAL037W | genetic | 27708008 | |
MTU1_YEAST | SLM3 | genetic | 27708008 | |
SAC3_YEAST | SAC3 | genetic | 27708008 | |
MRX10_YEAST | YDR282C | genetic | 27708008 | |
GNP1_YEAST | GNP1 | genetic | 27708008 | |
KCC1_YEAST | CMK1 | genetic | 27708008 | |
MTHR2_YEAST | MET13 | genetic | 27708008 | |
RMR1_YEAST | RMR1 | genetic | 27708008 | |
YG3L_YEAST | YGR149W | genetic | 27708008 | |
AP3B_YEAST | APL6 | genetic | 27708008 | |
THP2_YEAST | THP2 | genetic | 27708008 | |
PSMD9_YEAST | NAS2 | genetic | 27708008 | |
ASF1_YEAST | ASF1 | genetic | 27708008 | |
RL40A_YEAST | RPL40B | genetic | 27708008 | |
RL40B_YEAST | RPL40B | genetic | 27708008 | |
BRE2_YEAST | BRE2 | genetic | 27708008 | |
ALAM_YEAST | ALT1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...