UniProt ID | YN227_YEAST | |
---|---|---|
UniProt AC | Q3E7Z0 | |
Protein Name | Uncharacterized protein YNL277W-A | |
Gene Name | YNL277W-A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 62 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MTLAYYGQPVKMCHILPPLRSLPVLVGKKKLKKKKSQTTNNHVIFLFTLFIKLLKTHNRMSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YN227_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YN227_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YN227_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YN227_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GPR1_YEAST | GPR1 | genetic | 27708008 | |
MED8_YEAST | MED8 | genetic | 27708008 | |
TCPD_YEAST | CCT4 | genetic | 27708008 | |
TIM44_YEAST | TIM44 | genetic | 27708008 | |
ERG27_YEAST | ERG27 | genetic | 27708008 | |
NEP1_YEAST | EMG1 | genetic | 27708008 | |
HAS1_YEAST | HAS1 | genetic | 27708008 | |
NOP2_YEAST | NOP2 | genetic | 27708008 | |
SGT1_YEAST | SGT1 | genetic | 27708008 | |
NIP7_YEAST | NIP7 | genetic | 27708008 | |
BUR1_YEAST | SGV1 | genetic | 27708008 | |
YCZ2_YEAST | YCR102C | genetic | 27708008 | |
MSH4_YEAST | MSH4 | genetic | 27708008 | |
SPO74_YEAST | SPO74 | genetic | 27708008 | |
YG3A_YEAST | YGR130C | genetic | 27708008 | |
SNF6_YEAST | SNF6 | genetic | 27708008 | |
EMC5_YEAST | EMC5 | genetic | 27708008 | |
TED1_YEAST | TED1 | genetic | 27708008 | |
THIK_YEAST | POT1 | genetic | 27708008 | |
GBLP_YEAST | ASC1 | genetic | 27708008 | |
SCS7_YEAST | SCS7 | genetic | 27708008 | |
KTR1_YEAST | KTR1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...