UniProt ID | YGK5_SCHPO | |
---|---|---|
UniProt AC | O94323 | |
Protein Name | Uncharacterized pyrophosphatase/phosphodiesterase C725.05c | |
Gene Name | SPBC725.05c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 485 | |
Subcellular Localization |
Membrane Single-pass type II membrane protein . |
|
Protein Description | ||
Protein Sequence | MFSWANIGSNEYLPLKNDRKAYLNQWAKRSGLAIAAICILGILILAIVKLFCFKAIIFPIVGGSFNNGTNVFQSTVIVISLDGFRADYLYRGFTPNLLSLAERNVHVPFLIPSFPSITFPNHYTIVTGLYPESHGIVSNNFFDPVTGKQFVNSMPECNKDPTWWDKGEPIWVNAERNNVRSAVHMWPGNEVENHGYRPTYSDGFNFDTTLREKKDRILEWLDLPDKDRPQLLLAYAPHVDMVGHAFGPDSPELNIIIQEVDIVIGELIEGLKKRNIDKHVNIIFLSDHGMAPTSDNRLIWLDNMFNLSAVAHRDAWPLGGFRGESDLDDEYIYESLVNYSRSSLPSAENWNVYSKKDIPSRWHYSNNERIAPVWMIPDVGWSLVSMLDHSPELEYEPLGVHGYDNLSPVMRALFIASGSSFKNFKGKKLAPFQNTEIYGILSHILDLPAQPNNGTYEGALPLRRNRNSTKEWLLKDIEQAYSKLI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MFSWANIGSN -----CCCCCCCCCC | 24.79 | 29996109 | |
9 | Phosphorylation | FSWANIGSNEYLPLK CCCCCCCCCCCCCCC | 23.77 | 24763107 | |
12 | Phosphorylation | ANIGSNEYLPLKNDR CCCCCCCCCCCCCCH | 20.19 | 25720772 | |
67 | N-linked_Glycosylation | IVGGSFNNGTNVFQS HHCCCCCCCCCEECE | 57.57 | - | |
306 | N-linked_Glycosylation | IWLDNMFNLSAVAHR EEECCCCCHHHHCCC | 23.47 | - | |
338 | N-linked_Glycosylation | YIYESLVNYSRSSLP HHHHHHHHCCCCCCC | 34.06 | - | |
453 | N-linked_Glycosylation | DLPAQPNNGTYEGAL CCCCCCCCCCCCCCE | 51.36 | - | |
467 | N-linked_Glycosylation | LPLRRNRNSTKEWLL EECCCCCCCCCHHHH | 58.54 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YGK5_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YGK5_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YGK5_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...