dbPTM

SRY_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SRY_HUMAN
UniProt AC	Q05066
Protein Name	Sex-determining region Y protein
Gene Name	SRY
Organism	Homo sapiens (Human).
Sequence Length	204
Subcellular Localization	Nucleus speckle . Cytoplasm . Nucleus . Acetylation contributes to its nuclear localization and deacetylation by HDAC3 induces a cytoplasmic delocalization (PubMed:15297880). Colocalizes with SOX6 in speckles (PubMed:11818535). Colocalizes with CAML
Protein Description	Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells (By similarity). In male adult brain involved in the maintenance of motor functions of dopaminergic neurons (By similarity). Involved in different aspects of gene regulation including promoter activation or repression (By similarity). Promotes DNA bending. SRY HMG box recognizes DNA by partial intercalation in the minor groove. Also involved in pre-mRNA splicing. Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'..
Protein Sequence	MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
33	Phosphorylation	PALRRSSSFLCTESC CHHHHCCCEEECCCC	24.39	30576142
42	Phosphorylation	LCTESCNSKYQCETG EECCCCCCCEEECCC	36.75	-
124	Phosphorylation	QAMHREKYPNYKYRP HHHHHHHCCCCCCCC	7.61	29759185
136	Acetylation	YRPRRKAKMLPKNCS CCCCHHCCCCCCCCC	43.96	15297880
169	Phosphorylation	RLYRDDCTKATHSRM CEECCCCCHHHHHHH	30.61	30266825
172	Phosphorylation	RDDCTKATHSRMEHQ CCCCCHHHHHHHHHH	23.18	30266825
174	Phosphorylation	DCTKATHSRMEHQLG CCCHHHHHHHHHHHC	29.03	30266825

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SRY_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
136	K	Acetylation		15297880
Acetylation of Lys-136 contributes to its nuclear localization and enhances its interaction with KPNB1.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SRY_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SP1_HUMAN	SP1	physical	19661285
XPO4_MOUSE	Xpo4	physical	19349578
EP300_HUMAN	EP300	physical	15297880
HDAC3_HUMAN	HDAC3	physical	15297880
WDR5_HUMAN	WDR5	physical	22523547
DLX5_MOUSE	Dlx5	physical	16582099
HHEX_MOUSE	Hhex	physical	16582099
UTF1_MOUSE	Utf1	physical	16582099
PO3F3_MOUSE	Pou3f3	physical	16582099
HTF4_MOUSE	Tcf12	physical	16582099
OLIG2_MOUSE	Olig2	physical	16582099
JUN_MOUSE	Jun	physical	16582099
CEBPA_MOUSE	Cebpa	physical	16582099
EGR2_MOUSE	Egr2	physical	16582099
SP1_MOUSE	Sp1	physical	16582099
PAX3_MOUSE	Pax3	physical	16582099

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
400044	46,XY sex reversal 1 (SRXY1)
	Note=A 45,X chromosomal aberration involving SRY is found in Turner syndrome, a disease characterized by gonadal dysgenesis with short stature, "streak gonads", variable abnormalities such as webbing of the neck, cubitus valgus, cardiac defects, low posterior hair line. The phenotype is female.
400045
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SRY_HUMAN

Related Literatures of Post-Translational Modification

Acetylation
Reference	PubMed
"Regulation of human SRY subcellular distribution by itsacetylation/deacetylation."; Thevenet L., Mejean C., Moniot B., Bonneaud N., Galeotti N.,Aldrian-Herrada G., Poulat F., Berta P., Benkirane M.,Boizet-Bonhoure B.; EMBO J. 23:3336-3345(2004). Cited for: INTERACTION WITH EP300; HDAC3 AND KPNB1, ACETYLATION AT LYS-136,MUTAGENESIS OF LYS-115; LYS-123; LYS-128; LYS-134 AND LYS-136, ANDSUBCELLULAR LOCATION.	15297880 [Abstract]