| UniProt ID | SRY_HUMAN | |
|---|---|---|
| UniProt AC | Q05066 | |
| Protein Name | Sex-determining region Y protein | |
| Gene Name | SRY | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 204 | |
| Subcellular Localization | Nucleus speckle . Cytoplasm . Nucleus . Acetylation contributes to its nuclear localization and deacetylation by HDAC3 induces a cytoplasmic delocalization (PubMed:15297880). Colocalizes with SOX6 in speckles (PubMed:11818535). Colocalizes with CAML | |
| Protein Description | Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells (By similarity). In male adult brain involved in the maintenance of motor functions of dopaminergic neurons (By similarity). Involved in different aspects of gene regulation including promoter activation or repression (By similarity). Promotes DNA bending. SRY HMG box recognizes DNA by partial intercalation in the minor groove. Also involved in pre-mRNA splicing. Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'.. | |
| Protein Sequence | MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 33 | Phosphorylation | PALRRSSSFLCTESC CHHHHCCCEEECCCC | 24.39 | 30576142 | |
| 42 | Phosphorylation | LCTESCNSKYQCETG EECCCCCCCEEECCC | 36.75 | - | |
| 124 | Phosphorylation | QAMHREKYPNYKYRP HHHHHHHCCCCCCCC | 7.61 | 29759185 | |
| 136 | Acetylation | YRPRRKAKMLPKNCS CCCCHHCCCCCCCCC | 43.96 | 15297880 | |
| 169 | Phosphorylation | RLYRDDCTKATHSRM CEECCCCCHHHHHHH | 30.61 | 30266825 | |
| 172 | Phosphorylation | RDDCTKATHSRMEHQ CCCCCHHHHHHHHHH | 23.18 | 30266825 | |
| 174 | Phosphorylation | DCTKATHSRMEHQLG CCCHHHHHHHHHHHC | 29.03 | 30266825 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRY_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 136 | K | Acetylation |
| 15297880 |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRY_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SP1_HUMAN | SP1 | physical | 19661285 | |
| XPO4_MOUSE | Xpo4 | physical | 19349578 | |
| EP300_HUMAN | EP300 | physical | 15297880 | |
| HDAC3_HUMAN | HDAC3 | physical | 15297880 | |
| WDR5_HUMAN | WDR5 | physical | 22523547 | |
| DLX5_MOUSE | Dlx5 | physical | 16582099 | |
| HHEX_MOUSE | Hhex | physical | 16582099 | |
| UTF1_MOUSE | Utf1 | physical | 16582099 | |
| PO3F3_MOUSE | Pou3f3 | physical | 16582099 | |
| HTF4_MOUSE | Tcf12 | physical | 16582099 | |
| OLIG2_MOUSE | Olig2 | physical | 16582099 | |
| JUN_MOUSE | Jun | physical | 16582099 | |
| CEBPA_MOUSE | Cebpa | physical | 16582099 | |
| EGR2_MOUSE | Egr2 | physical | 16582099 | |
| SP1_MOUSE | Sp1 | physical | 16582099 | |
| PAX3_MOUSE | Pax3 | physical | 16582099 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 400044 | 46,XY sex reversal 1 (SRXY1) | |||||
| Note=A 45,X chromosomal aberration involving SRY is found in Turner syndrome, a disease characterized by gonadal dysgenesis with short stature, "streak gonads", variable abnormalities such as webbing of the neck, cubitus valgus, cardiac defects, low posterior hair line. The phenotype is female. | ||||||
| 400045 | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Regulation of human SRY subcellular distribution by itsacetylation/deacetylation."; Thevenet L., Mejean C., Moniot B., Bonneaud N., Galeotti N.,Aldrian-Herrada G., Poulat F., Berta P., Benkirane M.,Boizet-Bonhoure B.; EMBO J. 23:3336-3345(2004). Cited for: INTERACTION WITH EP300; HDAC3 AND KPNB1, ACETYLATION AT LYS-136,MUTAGENESIS OF LYS-115; LYS-123; LYS-128; LYS-134 AND LYS-136, ANDSUBCELLULAR LOCATION. | |