UniProt ID | SPF27_MOUSE | |
---|---|---|
UniProt AC | Q9D287 | |
Protein Name | Pre-mRNA-splicing factor SPF27 | |
Gene Name | Bcas2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 225 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR).. | |
Protein Sequence | MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAGTGLVAG ------CCCCCCCCC | 25.01 | - | |
94 | Phosphorylation | YELPAPSSGQKNDIT EECCCCCCCCCCCHH | 44.15 | - | |
173 | Phosphorylation | QRKNMQLTAGSKLRE HHHHCCCCCCHHHHH | 16.45 | 28059163 | |
187 | Phosphorylation | EMESNWVSLVSKNYE HHHHHHHHHHHCCCE | 18.05 | 24759943 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPF27_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPF27_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPF27_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...