UniProt ID | SHRPN_MOUSE | |
---|---|---|
UniProt AC | Q91WA6 | |
Protein Name | Sharpin | |
Gene Name | Sharpin | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 380 | |
Subcellular Localization | Cytoplasm, cytosol. Cell junction, synapse. Enriched at synaptic sites in mature neurons where it colocalizes with SHANK1.. | |
Protein Description | Component of the LUBAC complex which conjugates linear polyubiquitin chains in a head-to-tail manner to substrates and plays a key role in NF-kappa-B activation and regulation of inflammation. LUBAC conjugates linear polyubiquitin to IKBKG and RIPK1 and is involved in activation of the canonical NF-kappa-B and the JNK signaling pathways. Linear ubiquitination mediated by the LUBAC complex interferes with TNF-induced cell death and thereby prevents inflammation. LUBAC is proposed to be recruited to the TNF-R1 signaling complex (TNF-RSC) following polyubiquitination of TNF-RSC components by BIRC2 and/or BIRC3 and to conjugate linear polyubiquitin to IKBKG and possibly other components contributing to the stability of the complex. Together with FAM105B/otulin, the LUBAC complex regulates the canonical Wnt signaling during angiogenesis.. | |
Protein Sequence | MSPPAGGAAVAADPASPVVLLAVHAAVRPLGAGQDAEAQPRKLQLIADPERPGRFRLGLLGTEPGAVSLEWPLEAICYTVRGPNQHELQPPPGGPGTFSVHFLDPEEAQQWAALVRDATAEGQNGSGSPAPAPAPAMCPISPPCSSMAQIPKATQPEVDLPQSSGNFKKEELATRLSQAIAGGDEKAAAQVAAVLAQHHVALNVQLMEAWFPPGPIRLQVTVEDATSVLSSSSSAHVSLKIHPHCSIAALQDQVFSEFGFPPAVQRWVIGRCLCMPERSLASYGVSQDGDPAFLYLLSAPREVSGQSLQNSKMDRKLGLFPQSLGLPHDLQPSSSSLPSPSQPGWSCPSCTFINASNRPGCEMCSTQRPCAWDPLAAAST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 | Ubiquitination | AAVRPLGAGQDAEAQ HHHCCCCCCCCCCCC | 21.84 | 27667366 | |
42 | Ubiquitination | DAEAQPRKLQLIADP CCCCCCCEEEEEECC | 47.47 | - | |
141 | Phosphorylation | APAMCPISPPCSSMA CCCCCCCCCCCCHHH | 14.13 | 28285833 | |
163 | Phosphorylation | PEVDLPQSSGNFKKE CCCCCCCCCCCCCHH | 37.97 | - | |
168 | Ubiquitination | PQSSGNFKKEELATR CCCCCCCCHHHHHHH | 64.37 | 27667366 | |
169 | Ubiquitination | QSSGNFKKEELATRL CCCCCCCHHHHHHHH | 52.89 | - | |
174 | Phosphorylation | FKKEELATRLSQAIA CCHHHHHHHHHHHHH | 44.78 | 25338131 | |
176 | Ubiquitination | KEELATRLSQAIAGG HHHHHHHHHHHHHCC | 3.75 | 27667366 | |
186 | Ubiquitination | AIAGGDEKAAAQVAA HHHCCCHHHHHHHHH | 48.33 | - | |
260 | Ubiquitination | QVFSEFGFPPAVQRW HHHHHHCCCHHHHHH | 8.76 | 27667366 | |
307 | Phosphorylation | PREVSGQSLQNSKMD CCCCCCCHHHCCHHH | 35.13 | 30352176 | |
312 | Ubiquitination | GQSLQNSKMDRKLGL CCHHHCCHHHHHCCC | 52.98 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SHRPN_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SHRPN_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SHRPN_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EYA1_MOUSE | Eya1 | physical | 20956555 | |
HOIL1_MOUSE | Rbck1 | physical | 21455181 | |
RNF31_MOUSE | Rnf31 | physical | 21455181 | |
FYB1_MOUSE | Fyb | physical | 21829440 | |
SCNBA_MOUSE | Scn11a | physical | 21829440 | |
ZN106_MOUSE | Zfp106 | physical | 21829440 | |
STK24_MOUSE | Stk24 | physical | 21829440 | |
CUX1_MOUSE | Cux1 | physical | 21829440 | |
TRAF2_MOUSE | Traf2 | physical | 21829440 | |
TEKT4_MOUSE | Tekt4 | physical | 21829440 | |
ASAP2_MOUSE | Asap2 | physical | 21829440 | |
CEBPA_MOUSE | Cebpa | physical | 21829440 | |
PSMD1_MOUSE | Psmd1 | physical | 21829440 | |
PACA_MOUSE | Adcyap1 | physical | 21829440 | |
BRE1A_MOUSE | Rnf20 | physical | 21829440 | |
AIFM1_MOUSE | Aifm1 | physical | 21829440 | |
UCHL1_MOUSE | Uchl1 | physical | 21829440 | |
SURF6_MOUSE | Surf6 | physical | 21829440 | |
CAN13_MOUSE | Capn13 | physical | 21829440 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...