EYA1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: EYA1_MOUSE
• UniProt AC: P97767
• Protein Name: Eyes absent homolog 1
• Gene Name: Eya1
• Organism: Mus musculus (Mouse).
• Sequence Length: 591
• Subcellular Localization: Cytoplasm . Nucleus . Localizes at sites of DNA damage at double-strand breaks (DSBs).
• Protein Description: Functions both as protein phosphatase and as transcriptional coactivator for SIX1, and probably also for SIX2, SIX4 and SIX5. [PubMed: 10490620 Tyrosine phosphatase that dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph) and promotes efficient DNA repair via the recruitment of DNA repair complexes containing MDC1. 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress]
• Protein Sequence: MEMQDLTSPHSRLSGSSESPSGPKLDSSHINSTSMTPNGTEVKTEPMSSSEIASTAADGSLDSFSGSALGSSSFSPRPAHPFSPPQIYPSKSYPHILPTPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTESGLSQSQSPGQTGFLSYGTSFGTPQPGQAPYSYQMQGSSFTTSSGLYSGNNSLTNSSGFNSSQQDYPSYPGFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPPSGVTSQAVTDPTAEYSTIHSPSTPIKETDSERLRRGSDGKSRGRGRRNNNPSPPPDSDLERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSANLCLATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRVSSHSDLMALHHALELEYL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MEMQDLTSPHSRLS -CCCCCCCCCCCCCC	48.80	30635358
8	Phosphorylation	MEMQDLTSPHSRLSG CCCCCCCCCCCCCCC	28.10	30635358
11	Phosphorylation	QDLTSPHSRLSGSSE CCCCCCCCCCCCCCC	38.00	30635358
16	Phosphorylation	PHSRLSGSSESPSGP CCCCCCCCCCCCCCC	27.79	29550500
17	Phosphorylation	HSRLSGSSESPSGPK CCCCCCCCCCCCCCC	45.69	29550500
19	Phosphorylation	RLSGSSESPSGPKLD CCCCCCCCCCCCCCC	26.72	27841257
21	Phosphorylation	SGSSESPSGPKLDSS CCCCCCCCCCCCCCH	76.61	29550500
55	Phosphorylation	SSSEIASTAADGSLD CHHHHHHHHCCCCCC	19.49	-
313	Phosphorylation	GRRNNNPSPPPDSDL CCCCCCCCCCCCCCC	52.76	26824392
318	Phosphorylation	NPSPPPDSDLERVFI CCCCCCCCCCCEEEE	50.28	26160508

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of EYA1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of EYA1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of EYA1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SHRPN_MOUSE	Sharpin	physical	20956555
SIX1_MOUSE	Six1	genetic	22513373
SMRC2_MOUSE	Smarcc2	physical	22513373
SMRC2_MOUSE	Smarcc2	genetic	22513373
SOX2_MOUSE	Sox2	genetic	22513373
SMCA4_MOUSE	Smarca4	genetic	22513373
SMRC1_MOUSE	Smarcc1	genetic	22513373
SMCA4_MOUSE	Smarca4	physical	22513373
NDF1_MOUSE	Neurod1	physical	22513373
NGN1_MOUSE	Neurog1	physical	22513373
SOX2_MOUSE	Sox2	physical	22513373
SIX1_MOUSE	Six1	genetic	22340499
SOX2_MOUSE	Sox2	genetic	22340499
SOX2_MOUSE	Sox2	physical	22340499
SIX1_MOUSE	Six1	physical	15492887
SIX2_MOUSE	Six2	physical	16024294
SIX3_MOUSE	Six3	physical	16024294
DACH1_MOUSE	Dach1	physical	11950062
SIX1_MOUSE	Six1	physical	11950062
SIX2_MOUSE	Six2	physical	11950062
GNAZ_MOUSE	Gnaz	physical	11950062
GNAI2_MOUSE	Gnai2	physical	11950062

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.