UniProt ID | PACA_MOUSE | |
---|---|---|
UniProt AC | O70176 | |
Protein Name | Pituitary adenylate cyclase-activating polypeptide | |
Gene Name | Adcyap1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 175 | |
Subcellular Localization | Secreted. | |
Protein Description | Binding to its receptor activates G proteins and stimulates adenylate cyclase in pituitary cells (By similarity). Promotes neuron projection development through the RAPGEF2/Rap1/B-Raf/ERK pathway (By similarity). In chromaffin cells, induces long-lasting increase of intracellular calcium concentrations and neuroendocrine secretion (By similarity). Involved in the control of glucose homeostasis, induces insulin secretion by pancreatic beta cells. [PubMed: 23913443] | |
Protein Sequence | MTMCSGARLALLVYGIIMHSSVSCSPAAGLSFPGIRPEDEAYDQDGNPLQDFYDWDPPGVGSPASALRDAYALYYPADRRDVAHEILNEAYRKVLDQLSARKYLQSVVARGAGENLGGSAVDDPAPLTKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
157 | Leucine amide | KKYLAAVLGKRYKQR HHHHHHHHHHHHHHH | 6.00 | - | |
157 | Amidation | KKYLAAVLGKRYKQR HHHHHHHHHHHHHHH | 6.00 | - | |
168 | Lysine amide | YKQRVKNKGRRIAYL HHHHHHHCCCCEECC | 48.34 | - | |
168 | Amidation | YKQRVKNKGRRIAYL HHHHHHHCCCCEECC | 48.34 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PACA_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PACA_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PACA_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PACA_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...