UniProt ID | SECU_SCHPO | |
---|---|---|
UniProt AC | P21135 | |
Protein Name | Securin | |
Gene Name | cut2 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 301 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | Regulatory protein, which plays a central role in chromosome stability. Probably acts by blocking the action of key proteins. During the mitosis, it blocks separase/cut1 function, preventing the proteolysis of the cohesin complex and the subsequent segregation of the chromosomes. At the onset of anaphase, it is ubiquitinated, conducting to its destruction and to the liberation of cut1.. | |
Protein Sequence | MLPRTMFSYGKENAFPVTPISNRNGTKGAGSKRAPLGSTKQSNAPSSVTVPRTVLGGKSTNISKFISAPSTKKMSPMDISMDSPTILEPNSQGISRSAVQERSKRLSASPRRSSLTDTPLPNELEEDIEYMPPPVHLDPIQSLGFDDVAIDCETLDPWPSMQNKATSVTIRNTPASDFHVYKEFSDDDPIQFPLLSVDGDSPLTEKDTNLTTPATLKASDQQRKVLEKPSVSKQSSSRTRLSTVYRTKLASGKSIPRPLSHKLTRPRVTASGNSRRRPLSRSIHSLSSSRIDFSSLDTGLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
18 | Phosphorylation | KENAFPVTPISNRNG CCCCCCCCCCCCCCC | 18.36 | 24763107 | |
42 | Phosphorylation | PLGSTKQSNAPSSVT CCCCCCCCCCCCCEE | 36.19 | 21712547 | |
46 | Phosphorylation | TKQSNAPSSVTVPRT CCCCCCCCCEEECCE | 34.72 | 21712547 | |
47 | Phosphorylation | KQSNAPSSVTVPRTV CCCCCCCCEEECCEE | 22.28 | 29996109 | |
53 | Phosphorylation | SSVTVPRTVLGGKST CCEEECCEEECCCCC | 17.64 | 21712547 | |
67 | Phosphorylation | TNISKFISAPSTKKM CCHHHHCCCCCCCCC | 36.94 | 24763107 | |
71 | Phosphorylation | KFISAPSTKKMSPMD HHCCCCCCCCCCCCC | 33.36 | 24763107 | |
75 | Phosphorylation | APSTKKMSPMDISMD CCCCCCCCCCCCCCC | 26.42 | 21712547 | |
83 | Phosphorylation | PMDISMDSPTILEPN CCCCCCCCCCCCCCC | 18.46 | 21712547 | |
185 | Phosphorylation | FHVYKEFSDDDPIQF EEEEECCCCCCCCCC | 41.02 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SECU_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SECU_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SECU_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...