UniProt ID | KAPB_SCHPO | |
---|---|---|
UniProt AC | P40376 | |
Protein Name | cAMP-dependent protein kinase catalytic subunit | |
Gene Name | pka1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 512 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MDTTAVASKGSTNVGSSTDTLSTSASLHPSMNAGSVNEYSEQQRHGTNSFNGKPSVHDSVGSDASVSNGHNNHNESSLWTSGIPKALEEATKSKKPDSLVSTSTSGCASAHSVGYQNIDNLIPSPLPESASRSSSQSSHQRHSRDGRGELGSEHGERRSAMDGLRDRHIRKVRVSQLLDLQRRRIRPADHTTKDRYGIQDFNFLQTLGTGSFGRVHLVQSNHNRLYYAIKVLEKKKIVDMKQIEHTCDERYILSRVQHPFITILWGTFQDAKNLFMVMDFAEGGELFSLLRKCHRFPEKVAKFYAAEVILALDYLHHNQIVYRDLKPENLLLDRFGHLKIVDFGFAKRVSTSNCCTLCGTPDYLAPEIISLKPYNKAADWWSLGILIFEMLAGYPPFYSENPMKLYENILEGKVNYPSYFSPASIDLLSHLLQRDITCRYGNLKDGSMDIIMHPWFRDISWDKILTRKIEVPYVPPIQAGMGDSSQFDAYADVATDYGTSEDPEFTSIFKDF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
152 | Phosphorylation | DGRGELGSEHGERRS CCCCCCCCCHHHHHH | 38.76 | 29996109 | |
350 | Phosphorylation | FGFAKRVSTSNCCTL CCCCCCEECCCCCCC | 30.10 | 25720772 | |
351 | Phosphorylation | GFAKRVSTSNCCTLC CCCCCEECCCCCCCC | 22.54 | 25720772 | |
352 | Phosphorylation | FAKRVSTSNCCTLCG CCCCEECCCCCCCCC | 21.99 | 25720772 | |
356 | Phosphorylation | VSTSNCCTLCGTPDY EECCCCCCCCCCCCC | 27.55 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KAPB_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KAPB_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KAPB_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SCK1_SCHPO | sck1 | genetic | 7498728 | |
SCK1_SCHPO | sck1 | genetic | 11180454 | |
SCK2_SCHPO | sck2 | genetic | 9560431 | |
SCK1_SCHPO | sck1 | genetic | 9560431 | |
ESC1_SCHPO | esc1 | genetic | 16143612 | |
SRO1_SCHPO | sro1 | physical | 18410345 | |
HAP5_SCHPO | php5 | genetic | 11238405 | |
HOG1_SCHPO | sty1 | genetic | 20453258 | |
KAPR_SCHPO | cgs1 | physical | 21869531 | |
KAPR_SCHPO | cgs1 | physical | 21879336 | |
PRZ1_SCHPO | prz1 | genetic | 22496451 | |
PYP1_SCHPO | pyp1 | genetic | 8832414 | |
PYP2_SCHPO | pyp2 | genetic | 8832414 | |
TPS1_SCHPO | tps1 | genetic | 9302019 | |
ATF1_SCHPO | atf1 | physical | 23640764 | |
RAD24_SCHPO | rad24 | genetic | 19584544 | |
RAD25_SCHPO | rad25 | genetic | 19584544 | |
SDS23_SCHPO | sds23 | physical | 23640764 | |
WIS1_SCHPO | wis1 | genetic | 23640764 | |
SDS23_SCHPO | sds23 | genetic | 23640764 | |
PHX1_SCHPO | phx1 | genetic | 25102102 | |
GAD8_SCHPO | gad8 | genetic | 24928510 | |
MSA1_SCHPO | msa1 | genetic | 15166138 | |
NRD1_SCHPO | nrd1 | genetic | 15166138 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...