dbPTM

ESC1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ESC1_SCHPO
UniProt AC	Q04635
Protein Name	Protein esc1
Gene Name	esc1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	413
Subcellular Localization	Nucleus .
Protein Description	Involved in the sexual differentiation process. Modulate the ability of the cell to differentiate in response to the nitrogen starvation signal; in particular in response to decreases in the level of cellular cAMP..
Protein Sequence	MSSYALPSMQPTPTSSIPLRQMSQPTTSAPSNSASSTPYSPQQVPLTHNSYPLSTPSSFQHGQTRLPPINCLAEPFNRPQPWHSNSAAPASSSPTSATLSTAAHPVHTNAAQVAGSSSSYVYSVPPTNSTTSQASAKHSAVPHRSSQFQSTTLTPSTTDSSSTDVSSSDSVSTSASSSNASNTVSVTSPASSSATPLPNQPSQQQFLVSKNDAFTTFVHSVHNTPMQQSMYVPQQQTSHSSGASYQNESANPPVQSPMQYSYSQGQPFSYPQHKNQSFSASPIDPSMSYVYRAPESFSSINANVPYGRNEYLRRVTSLVPNQPEYTGPYTRNPELRTSHKLAERKRRKEIKELFDDLKDALPLDKSTKSSKWGLLTRAIQYIEQLKSEQVALEAYVKSLEENMQSNKEVTKGT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ESC1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ESC1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ESC1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ESC1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
ESC1_SCHPO	esc1	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ESC1_SCHPO

Related Literatures of Post-Translational Modification