UniProt ID | RAB5B_MOUSE | |
---|---|---|
UniProt AC | P61021 | |
Protein Name | Ras-related protein Rab-5B | |
Gene Name | Rab5b | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 215 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side. Early endosome membrane Lipid-anchor. Melanosome. |
|
Protein Description | Protein transport. Probably involved in vesicular traffic (By similarity).. | |
Protein Sequence | MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MTSRSTARP ------CCCCCCCCC | 32.61 | - | |
29 | Phosphorylation | KLVLLGESAVGKSSL EEEEECCCCCCCCHH | 26.84 | 22817900 | |
33 | Ubiquitination | LGESAVGKSSLVLRF ECCCCCCCCHHHHHH | 30.21 | - | |
34 | Phosphorylation | GESAVGKSSLVLRFV CCCCCCCCHHHHHHH | 23.99 | 23737553 | |
35 | Phosphorylation | ESAVGKSSLVLRFVK CCCCCCCHHHHHHHC | 26.44 | 23737553 | |
82 | Phosphorylation | DTAGQERYHSLAPMY ECCCCCCCHHHCCCH | 8.60 | 25367039 | |
84 | Phosphorylation | AGQERYHSLAPMYYR CCCCCCHHHCCCHHC | 19.79 | 25367039 | |
89 | Phosphorylation | YHSLAPMYYRGAQAA CHHHCCCHHCCCCEE | 6.75 | 29514104 | |
116 | Ubiquitination | ARAKTWVKELQRQAS HHHHHHHHHHHHHCC | 44.24 | - | |
123 | Phosphorylation | KELQRQASPSIVIAL HHHHHHCCCCEEEEE | 15.73 | 25521595 | |
125 | Phosphorylation | LQRQASPSIVIALAG HHHHCCCCEEEEECC | 27.30 | 25195567 | |
134 | Ubiquitination | VIALAGNKADLANKR EEEECCCHHHHCHHH | 42.22 | - | |
140 | Ubiquitination | NKADLANKRMVEYEE CHHHHCHHHHCCHHH | 35.94 | - | |
183 | Acetylation | AIAKKLPKSEPQNLG HHHHHCCCCCCCCCC | 77.28 | 23201123 | |
212 | Geranylgeranylation | SQQNKSQCCSN---- HHHHHHHHCCC---- | 3.38 | - | |
213 | Geranylgeranylation | QQNKSQCCSN----- HHHHHHHCCC----- | 3.20 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAB5B_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
84 | S | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAB5B_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LRRK2_MOUSE | Lrrk2 | physical | 18445495 | |
LRRK2_MOUSE | Lrrk2 | genetic | 18445495 | |
CDC27_HUMAN | CDC27 | physical | 26496610 | |
RAB5C_HUMAN | RAB5C | physical | 26496610 | |
XPO1_HUMAN | XPO1 | physical | 26496610 | |
KCAB2_HUMAN | KCNAB2 | physical | 26496610 | |
SPTC1_HUMAN | SPTLC1 | physical | 26496610 | |
UH1BL_HUMAN | UHRF1BP1L | physical | 26496610 | |
LTMD1_HUMAN | LETMD1 | physical | 26496610 | |
EIF3L_HUMAN | EIF3L | physical | 26496610 | |
ASXL2_HUMAN | ASXL2 | physical | 26496610 | |
AFAP1_HUMAN | AFAP1 | physical | 26496610 | |
RN123_HUMAN | RNF123 | physical | 26496610 | |
CLSPN_HUMAN | CLSPN | physical | 26496610 | |
DEPD7_HUMAN | DEPDC7 | physical | 26496610 | |
OSBL1_HUMAN | OSBPL1A | physical | 26496610 | |
TM201_HUMAN | TMEM201 | physical | 26496610 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...