| UniProt ID | PIR_HUMAN | |
|---|---|---|
| UniProt AC | O00625 | |
| Protein Name | Pirin | |
| Gene Name | PIR | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 290 | |
| Subcellular Localization | Nucleus . Cytoplasm . Predominantly localized in dot-like subnuclear structures. Cytoplasmic localization of PIR seems to positively correlate with melanoma progression. | |
| Protein Description | Transcriptional coregulator of NF-kappa-B which facilitates binding of NF-kappa-B proteins to target kappa-B genes in a redox-state-dependent manner. May be required for efficient terminal myeloid maturation of hematopoietic cells. Has quercetin 2,3-dioxygenase activity (in vitro).. | |
| Protein Sequence | MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | O-linked_Glycosylation | MGSSKKVTLSVLSRE CCCCCEEEEEEECHH | 23.38 | 29407107 | |
| 8 | Phosphorylation | MGSSKKVTLSVLSRE CCCCCEEEEEEECHH | 23.38 | 20068231 | |
| 10 | Phosphorylation | SSKKVTLSVLSREQS CCCEEEEEEECHHHH | 16.20 | 21406692 | |
| 13 | Phosphorylation | KVTLSVLSREQSEGV EEEEEEECHHHHCCC | 31.45 | 21406692 | |
| 17 | Phosphorylation | SVLSREQSEGVGARV EEECHHHHCCCCHHH | 31.40 | 24719451 | |
| 27 | Phosphorylation | VGARVRRSIGRPELK CCHHHHHHCCCHHHC | 20.87 | 28674419 | |
| 34 | Ubiquitination | SIGRPELKNLDPFLL HCCCHHHCCCCCEEE | 54.53 | - | |
| 97 | Methylation | LQWMTAGRGILHAEM HHHHCCCCCEEEEEC | 26.89 | 30760671 | |
| 131 | Phosphorylation | EKMVEPQYQELKSEE CCCCCHHHHHHHCCC | 18.05 | 27642862 | |
| 135 | Sumoylation | EPQYQELKSEEIPKP CHHHHHHHCCCCCCC | 55.88 | - | |
| 161 | Phosphorylation | GEALGIKSKVYTRTP CCCCCCCCEEEEECC | 25.98 | 24275569 | |
| 171 | Phosphorylation | YTRTPTLYLDFKLDP EEECCEEEEEEEECC | 13.50 | 27642862 | |
| 181 | Ubiquitination | FKLDPGAKHSQPIPK EEECCCCCCCCCCCC | 50.10 | - | |
| 183 | Phosphorylation | LDPGAKHSQPIPKGW ECCCCCCCCCCCCCC | 36.62 | - | |
| 234 | Acetylation | QVENKDPKRSHFVLI EECCCCCCCCEEEEE | 76.34 | 23954790 | |
| 275 | Ubiquitination | ILDFRNAKNGFERAK HHHHHHHCCHHHHHH | 62.24 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PIR_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIR_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIR_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
